SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000123970 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000123970
Domain Number 1 Region: 17-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000517
Family LIM domain 0.0048
Further Details:      
 
Domain Number 2 Region: 75-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000157
Family LIM domain 0.0047
Further Details:      
 
Domain Number 3 Region: 135-215
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000184
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000123970   Gene: ENSDARG00000003022   Transcript: ENSDART00000148513
Sequence length 242
Comment pep:novel chromosome:Zv9:21:39469383:39482904:-1 gene:ENSDARG00000003022 transcript:ENSDART00000148513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKSSQDLYCRRGGKARCCECNSVLADWYYERDGQFFCKKHYLSRFAEQCYGCTESINTG
PIMVAGKNKYHPECFLCESCDVFIGDGDSFALVDYTNLYCGQCHYQKVSTQHLAAKGSPL
PHMVTSMSFPPSAESRQGLFFTVEKKDKEHLVTVSQLDLHNLSAEVKPLIHVGDRILEIN
GISVHNIPLNEINLVIHDTEHWLQITIEHNPKDHIKQEDLSGLLGEELDQPGNLGFFPLP
NN
Download sequence
Identical sequences F8W473
ENSDARP00000123970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]