SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000124023 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000124023
Domain Number - Region: 12-51
Classification Level Classification E-value
Superfamily UBA-like 0.00221
Family CUE domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000124023   Gene: ENSDARG00000062063   Transcript: ENSDART00000148806
Sequence length 184
Comment pep:known chromosome:Zv9:8:19065333:19074422:1 gene:ENSDARG00000062063 transcript:ENSDART00000148806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAQGGPQLDYQILQDLRQRFPEIPETVVSQYLLQNNNNADLCYHLLAQESNRYLYEEYH
SPDDLHLNRNHMLRISVGYPVPDGVKNIPGGRALVHSSSDGHIEHPRSGFPEPLSAPATV
APSPGYNPFFKTDQSRSNIPTPPPSIPGMSPTYHPVSRYMTPITVTLSQNMPSAPQALQI
PPGT
Download sequence
Identical sequences F8W3V1
ENSDARP00000124023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]