SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000124293 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000124293
Domain Number 1 Region: 39-101
Classification Level Classification E-value
Superfamily Chromo domain-like 8.39e-23
Family Chromo domain 0.0000501
Further Details:      
 
Domain Number 2 Region: 126-155
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000258
Family Chromo domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000124293   Gene: ENSDARG00000054442   Transcript: ENSDART00000148668
Sequence length 155
Comment pep:putative chromosome:Zv9:12:30425955:30429822:-1 gene:ENSDARG00000054442 transcript:ENSDART00000148668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQISFASSLSRRDTTPVSQSEPKQITAGKKQNKKKVEEVVEEEEEEYVVEKVLDRRVVKG
KVEYLLKWKGFSDEDNTWEPDENLDCPDLIAEFLQSQKTAESGGKRRAETDGDGKETKKR
KDEPEKLRGFARGLDPERIIGATDSSGELMFLMKW
Download sequence
Identical sequences F8W402
ENSDARP00000124293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]