SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000125459 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000125459
Domain Number 1 Region: 509-691
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.99e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0017
Further Details:      
 
Domain Number 2 Region: 669-786
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.31e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000125459
Domain Number - Region: 362-423
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000125459   Gene: ENSDARG00000061986   Transcript: ENSDART00000150400
Sequence length 838
Comment pep:novel chromosome:Zv9:25:26457522:26484990:-1 gene:ENSDARG00000061986 transcript:ENSDART00000150400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFCMQAPNRQVMRYWLQQLQQKRWEFCNMPGPRDSWCSPTPLYPHTGLVARDAEAMPYEK
PSESMESVRNDFALELDNDGLIGHQTAHVPVAQPTAALSSLRQWGSEIRNSMSHLRPGRA
GENRRSVFYTGGSEDWEMVDPPTKDPAPSDCQHRESSSHFNRSSIGSAFTFDFRNPSKIK
RPFHSGSGKPNHSAESSPVEYNETKISKLQLRIQSQQEEISQLQEQENKLREELGSQKEL
VRLLQKTLRSAQCDWPSTVGPHNHYLEENEVDKALTERDTQIKDLCSHMEKLALEKESLQ
QELKGLKIKVGEINEQLGMLMETIQAKDEVIMKLSQPSGEGETQSAECNSPSVTREQQEL
NTLKDSLQGYKSQNKFLNKEIIELTVLRRNAESREKLLEAKYNSLEAKLCQVESKYLVLL
QEVKSPVCSSSEQTHSGDVITRLLEDALQVESTDQQEHPVLKPNAVSEYDIYGFKTVPEE
EDEEEKLEAKKRALDLKSLSLTDQETSVRVKWDNYLAITMNREMVRSPDLKALMRGGVPH
IHRSKVWSWCVSFHVKKMRDCQPKDYYHNLLCMANDKPNPACKQIELDLLRTLPNNKHYS
SPDSDGIQKLRNVLLAFSWRNPDIGYCQGLNRLAAIALLYLDQEDAFWCLVAIVEVFMPH
DYYTKTLLGSQVDQRVFKDLMYEKLPRLHAHFEHYKVDFSLITFNWFLVVFVDSVVSDIL
FKIWDSFLYEGPKIIFRFALALFKYKEEEFLKLQDPMTIFKYLRYFTRTILDARKLMAMA
FVDMNPFPLRQIQNRRTFHLEKVRLELTELEAIRQTFLRERESTMDGRTLISDDEEES
Download sequence
Identical sequences H0WF28
ENSDARP00000125459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]