SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000126141 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000126141
Domain Number 1 Region: 19-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-26
Family Nuclear receptor 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000126141   Gene: ENSDARG00000070721   Transcript: ENSDART00000151750
Sequence length 92
Comment pep:known chromosome:Zv9:6:38907880:38935997:-1 gene:ENSDARG00000070721 transcript:ENSDART00000151750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESAVSTSTQVPDEFDRNVPRICGVCGDKATGFHFNAMTCEGCKGFFRRSMKRKASFTCP
FNGSCTITKDNRRHCQACRLKRCLDIGMMKEC
Download sequence
Identical sequences I3IT83
ENSDARP00000126141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]