SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000126336 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000126336
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 84-138
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000995
Family BphP N-terminal domain-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000126336   Gene: ENSDARG00000058449   Transcript: ENSDART00000151956
Sequence length 145
Comment pep:known chromosome:Zv9:7:11554815:11558600:1 gene:ENSDARG00000058449 transcript:ENSDART00000151956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNTS
TDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNHPQSEWFGSTL
FEQVHPDDVDKLREQLSTSENSMTG
Download sequence
Identical sequences ENSDARP00000126336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]