SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000126363 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000126363
Domain Number 1 Region: 303-412
Classification Level Classification E-value
Superfamily ARID-like 9.94e-34
Family ARID domain 0.00032
Further Details:      
 
Domain Number 2 Region: 600-673
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000000589
Family Chromo barrel domain 0.013
Further Details:      
 
Domain Number 3 Region: 59-113
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000903
Family Tudor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000126363
Domain Number - Region: 534-573
Classification Level Classification E-value
Superfamily ARM repeat 0.0552
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000126363   Gene: ENSDARG00000043873   Transcript: ENSDART00000151847
Sequence length 1332
Comment pep:putative chromosome:Zv9:17:11241382:11281965:-1 gene:ENSDARG00000043873 transcript:ENSDART00000151847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRMVKVKVVLKGDSTSQVVQDDQVKGPL
RVGSTVEVKSPEGGLSEAVISKLTDASWYTVVFDDGDEKTLRRTSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKTNRGRRSSQAVAEDEKESSSSEDDDDDKRRLNDDLLGKVAC
VQSEPDDSWLCVLVISPSCNDDLTVKKDQCLVRSFADSKFHTVARKDVKEVNIDTLSKPE
YSLRKGCEAAKLFLQNRQIPDRWKVDLSEILESSSSDEDDEDEDGEGKEGEEEEKEPEPE
EPDDEPDPEERDHFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVHIHGGCDNIES
GSIWKQIYMDLGIPVLNSAASYNVKTAYRKYLYGFEEYCRSAQIQFRTVHHNEPRPDVQP
EVQSIKSVTKESENNDEMMQQVTAEPGTSEDKPAADADESDAESEKGRKDVCSPRGRRRC
LTTPVKVEMEPLKQEKIKEEKKKEDTQSVGENSGEEPKEKSDGEIPGKRRSRRHEESDKD
SEEDDDDNDDEEQDDDDEDDEEEEEDDDDEEEDYFERSRLRERDEREEGDGCEDSEHSLA
GTKVRVKYGKGKTQKIYEANIKNTETDDGEVLYLVHYYGWNVRYDEWVKADRIIWPVDKG
GTKKKQKKKVKNKEDEEKEKEEDKTKVVVRRGRPPLKSTPPGTSRKTPSSEGRSSSKNSR
PTDASALPNGDGTPRRRTRRTSGMYDSDRGSNDSGNSSDDSEGEKSPEKKQEWTERTDPP
PIAKQEAADDLPEESTTQEPAQTEPELPSSPQEMPNFNESESKPEEDSSMPPTESDVGSP
KMTAKKPRLKEPGSETPTQTPAAANHHAETEEPSTPPRPVKKSQETPHSSPVERIKLVET
AGSDTDSATEDIDPPERTSAAKRKINEQRTPEKKIRLDRKEEPKTPSPVKTSPLEKKPES
EKRTEIVQKPEEPPNPTLSSPSKEVEIKSEMPSLTREVHLKLEAPCPDLEDPTTVANEEM
MPQIGPEALVCHEVDLDDPEEKDKPSSEELPIMKEEKVLPQPLESPDHLHVLPAVGPPRL
FSPSSAPSPDESHSTKSESDATIEVDSVAESQEGLGENESTHSFDASASSSNSSISLQDR
DGKDRGQKRLLDCTTVSSSKKQKRSQKRSSVGCKTEKNGAGHSSDSEDQSVMDGSNKLTP
VKHSILPKNQKLSRSPGLGSPSNKYIEKDKHKEKQSVPSPRTYKWSCQLTELDNMSSAER
ISFLQDKLQEIRKYYMSLKSEVASIDRRRKRLKKKEREVSHTTASTSSGSSDTGMSPSSA
SPTQNTVAVECR
Download sequence
Identical sequences F1QWQ1
XP_005158686.1.45394 XP_005158688.1.45394 ENSDARP00000108603 ENSDARP00000126363 ENSDARP00000108603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]