SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000126821 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000126821
Domain Number 1 Region: 33-201
Classification Level Classification E-value
Superfamily L domain-like 3.15e-32
Family Leucine rich effector protein YopM 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000126821   Gene: ENSDARG00000076236   Transcript: ENSDART00000152529
Sequence length 255
Comment pep:novel chromosome:Zv9:12:2693006:2695341:1 gene:ENSDARG00000076236 transcript:ENSDART00000152529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKGKKKSSEPSGRKITLKMAKNALKVTVDGKRRLDLSNMAISTFPKCILKLCDVDELDL
SRNLLKKIPDAIDKFVNLRLLDLHSNHLEHLPAAIGRLQNLHNLNLCNNRLTSSSLPHEM
GFLRNLRILNLGMNCIDTLPPTVSALKELRELGLFNNLLTQLPKSLQNLPKLQKVNIKSN
PIPSDEDPEVDRIQRVESLYLVKEDCLCNDCLKKCREEREKLDSRMSAASTFKKSIFAGL
ITPNSVAQENQAVWR
Download sequence
Identical sequences R4GEA8
ENSDARP00000103543 ENSDARP00000126821 7955.ENSDARP00000103543 XP_697419.3.45394 ENSDARP00000103543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]