SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000127180 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000127180
Domain Number 1 Region: 40-102
Classification Level Classification E-value
Superfamily Chromo domain-like 5.07e-23
Family Chromo domain 0.0000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000127180   Gene: ENSDARG00000054442   Transcript: ENSDART00000139923
Sequence length 127
Comment pep:putative chromosome:Zv9:12:30419541:30429842:-1 gene:ENSDARG00000054442 transcript:ENSDART00000139923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTSEPSADAAVTEAPVSQSEPKQITAGKKQNKKKVEEVVEEEEEEYVVEKVLDRRVVK
GKVEYLLKWKGFSDEDNTWEPDENLDCPDLIAEFLQSQKTAESGGKRRAETDGDGKETKK
RKDEEKL
Download sequence
Identical sequences U3JB43
ENSDARP00000127180 ENSDARP00000127465 XP_005156296.1.45394 XP_005156297.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]