SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000127601 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000127601
Domain Number 1 Region: 980-1251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-69
Family Tandem AAA-ATPase domain 0.0000298
Further Details:      
 
Domain Number 2 Region: 707-978
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-54
Family Tandem AAA-ATPase domain 0.0000564
Further Details:      
 
Domain Number 3 Region: 461-519
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.42e-17
Family PHD domain 0.0000877
Further Details:      
 
Domain Number 4 Region: 357-429
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.3e-17
Family PHD domain 0.0019
Further Details:      
 
Domain Number 5 Region: 625-698
Classification Level Classification E-value
Superfamily Chromo domain-like 1.14e-16
Family Chromo domain 0.0053
Further Details:      
 
Domain Number 6 Region: 483-530,557-603
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000375
Family Chromo domain 0.019
Further Details:      
 
Domain Number 7 Region: 190-240
Classification Level Classification E-value
Superfamily HMG-box 0.000074
Family HMG-box 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000127601   Gene: ENSDARG00000021405   Transcript: ENSDART00000156717
Sequence length 2067
Comment pep:novel chromosome:Zv9:7:21828481:21928492:-1 gene:ENSDARG00000021405 transcript:ENSDART00000156717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLLRSCEEDEGTAVNSEGGDFDEEEEDDGDLDENASDINSPAAPRETAARAAPDDGDD
IGEASDRDNLGKKKRGPKKKKETKKKDKEKEGKIAKARKRKKIESDIERDSEPDYAMNSD
SAASDYGGEKKKKKKHKDKKEKKTKKKKKEDEDSTHEETTKPVEMKTSAQLAREWGLEDV
DHTFTEEDYRTLTNYKAFSQFLRPMIAKKNPKIPMSKMMTILGAKWREFSSNNPFKGSAA
AVAAAAAAAAAAVAEQVSAATASPEPPPQPPPLRKAKTKEGKGPGYKKRSKSPRVSDKKK
PKPKKMAPLRIKLGAIGNKRKKSSSSEEVDEDDSEQENSSVHSSSVRSDSSGRVKKNKRG
RPAKKKKKALGDEDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLEPELEKAPEG
KWSCPHCEKEGIQWEAKEEDFEEFEEECDDVRDVESGLGGEEEEDDHMEFCRVCKDGGEL
LCCDSCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPPIKGRVQKILHWRWGEPPPPVPVPP
PPDAPPDAPPPPPMKGRPEREFFVKLTAQSYWHCTWITELQLEIFHSVMFRNYQRKTDMD
EPPSLDYGSGGEEDSGKSEKRRAKDPQYAILEEKYYRYGIKPEWMMVHRIINHSVDKKGN
YHYLVKWRDLTYDQCTWERDELDIPEFALHKTAYWRHREAVMKEDPEKPRKMRRREENDE
APSTPVNDPTIKYEEQPEFVTETGGTLHLYQLEGLNWLRFSWAQGTDTILADEMGLGKTI
QTIVFLYSLFKEGHTKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKDSRAIIREN
EFTFDDTAVKGGKKAFKLRREAPIKFHVLLTSYELVTIDQNVLKSIDWACLVVDEAHRLK
NNQSKFFRRLNDYKIDHKLLLTGTPLQNNLEELFHLLNFLTPNRFNNLEGFLEEFADISK
EDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKFILTRNFEALNS
KGGGNQVSLLNIMMDLKKCCNHPYLFPVAAAEAPKTPSGAYEGVGLTKASGKLMLLQKML
RKLKEQGHRVLVFSQMTKMLDLLEDFLDSEGYKYERIDGGITGALRQEAIDRFNAPGAVQ
FCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRAS
VEERITQVAKRKMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDEIEAGDNKDD
DMSVIHYDNAAIERLLDRSQDATDDSDMQNMNEYLSSFKVAQYTVKEDDKIEEIEREIIK
QEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQEWHADISDNQS
EYSVGSEEEDEDFDERPEGRRQSRRQLRNEKDKPLPPLLARVGGNIEVLGFNTRQRKAFL
NAIMRWGMPAQDAFSSQWLVRDLRGKSEKEFKAYVSLFMRHLCEPVADGSETFADGVPRE
GLCRQPVLTRIGVMSLVKKKVQEFEHINGKWSMPELKPEITVDSKKSSRASSPTIKTDTP
TPELSCNNTPCTSKPATPSPPDKTEKSAKEAEKDEAESLTEPEREREKEKAKEAKEGESV
ESTEHGEATGNEGEKDPITSEKSQTSESPAAAASDDSKTKENPDISQSPPKEKNEKEKQE
EEEGKEKEPSTEKPSDSPSVKEESKEALKGDKKEKAGEEKEKTEASSPPSETTEKKDKLD
QSSEVKKEEVKGERDAGKEVRVQREEVPKVISRPAERPRFMFNIADGGFTELHTLWQNEE
RAAISSGKINEIWHRRHDFWLLSGIVCHGYARWQDIQNDPQFAIINEPFKTQANKGNFLE
MKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPTHPAMALNARFAEVECLAESHQHLS
KESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPATLSRVPPITARLQMSERSILSRL
ANKGNETHTPPPIPPGPYATPQNFGPPFTPAPSAALALAGANYSQMPPGSFISVLNGPPM
SVKKEREAELLMARREQRSGEVICIDD
Download sequence
Identical sequences X1WBL0
XP_005172292.1.45394 ENSDARP00000127601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]