SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000127630 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000127630
Domain Number 1 Region: 72-196
Classification Level Classification E-value
Superfamily PH domain-like 4.34e-21
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000127630   Gene: ENSDARG00000055400   Transcript: ENSDART00000153591
Sequence length 254
Comment pep:known_by_projection chromosome:Zv9:16:26865741:26885360:1 gene:ENSDARG00000055400 transcript:ENSDART00000153591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSVKCTQNNMRVEKKQKRYITQSVTSRFNTADKDRVYRPMPKSEMLSQDDPKSRPMLEL
REKLQPEVIELIKQQRLNRLCEGTCFRKISARRRQDKFWYCRLSPNHKVLHYGDIEEFSQ
GQISHDSLQDKVTVADIKAVVTGKDCPHMREKGALKNKELLELAFSILHNSDEYLNFIAP
DKHEYCIWTDGLNALLGKEMTTELTRSDMDTLVTMELKLRLLDLENIQIPDVAPPVPKEP
STYNFVYDFTQQHN
Download sequence
Identical sequences X1WBN8
ENSDARP00000127630 XP_002664936.1.45394 XP_005158206.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]