SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000127727 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000127727
Domain Number 1 Region: 6-65
Classification Level Classification E-value
Superfamily Chromo domain-like 1.04e-17
Family Chromo domain 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000127727
Domain Number - Region: 106-115,196-217
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0811
Family Formin homology 2 domain (FH2 domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000127727   Gene: ENSDARG00000097543   Transcript: ENSDART00000153551
Sequence length 502
Comment pep:novel chromosome:Zv9:3:24749530:24756035:1 gene:ENSDARG00000097543 transcript:ENSDART00000153551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSAAGDRVFAAEAILKRRVRKGRMEYLVKWKGWAIKYSTWEPEENILDERLVAAFEQK
EREQEMYGPKKRGPKPKTLLLKSRAQAESPRVPEFKHSRPQPHSKPPPPPPPAAPSYTPT
APSNAKLQSGTAQPKLKKDIHRCHRMARRPLPRQDHTVGPSGPFSSRPTVSAFSETVRIL
NRKVKPREVKKGRVILNLKVLDKAENTAVANNKRTHVPSTQQSHFGRQKIPSRNRVIGKN
RRFGEVSYRGIQPPIRGSGFPVFGKLFDSHSLKNAESGESRNSMTNNLSSSQSSKLLDVS
KGQNRNEEPPPSNSSSEVSDGEPPSPRQTQSQHSSLQPKASSTKSPSTKAPDPTLHKLGT
QPVASKNKDSASSALPSSPMFSSSSSASTSSEDNEHILDLSVPHEMDRRLRRRHPFSGRH
PLKVPEVPVSEEPSEEEEDLDWRPDMTSRCANVVVTDITANLLTVTIKEFCHPPSASSPP
CYSKNVSTQNDTQQPKQNPNKT
Download sequence
Identical sequences X1WBY5
ENSDARP00000127727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]