SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000127940 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000127940
Domain Number - Region: 17-40
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0183
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000127940   Gene: ENSDARG00000091646   Transcript: ENSDART00000154325
Sequence length 61
Comment pep:known_by_projection chromosome:Zv9:11:7255775:7258166:-1 gene:ENSDARG00000091646 transcript:ENSDART00000154325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFGSKGKKRMVLPTRPDPPTVEQIMEDVNRAYPNDPVFTVLHTSAEDLKGISSNGEVEE
R
Download sequence
Identical sequences A0A0R4IG97
ENSDARP00000127940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]