SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000128062 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000128062
Domain Number 1 Region: 682-981
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.92e-66
Family Tandem AAA-ATPase domain 0.0000656
Further Details:      
 
Domain Number 2 Region: 425-680
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.04e-59
Family Tandem AAA-ATPase domain 0.0000675
Further Details:      
 
Domain Number 3 Region: 2531-2617
Classification Level Classification E-value
Superfamily BRK domain-like 8.24e-26
Family BRK domain-like 0.0000386
Further Details:      
 
Domain Number 4 Region: 285-357
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000196
Family Chromo domain 0.018
Further Details:      
 
Domain Number 5 Region: 368-429
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000001
Family Chromo domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000128062   Gene: ENSDARG00000017244   Transcript: ENSDART00000155549
Sequence length 2935
Comment pep:known_by_projection chromosome:Zv9:6:51526743:51617558:-1 gene:ENSDARG00000017244 transcript:ENSDART00000155549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIQKKDKQMSASYVLKHTPSAAASNASDQNAQTTFPIGHLGKEQLRIIGGPPNHCMAHP
KHSGPAVSSHSLRPSMINNEEDDGGGGTKVKKKRRKKDKKESEWHEDGQSNAKPKRREQK
EGKEILPRKTKTAKEQKDHKKRDAKAQKEVKKVKKGQDVKVKTLAKNQCATHTPSKRGRK
PKEQGAMPPEKKKKGKRKSDAVLEMVESDDTASLSTLATGGEESTDPMDNTKRRSGRQVK
RRKYNEDLDFKVVDDDGETIAVLGSGRIAAMSSSTLAWQAEEPPEDEANIIEKILSVRTV
NKEMAPDEPPEEMEEFYVKYRNFSYLHCKWATLEELEKDPRIHQKIKRFRNKQAQMKHIF
TEPDEDLFNPDYIEVDRVLEIAITTDTETGEEVTHYLVKWCSLSYEESTWELQEDVDPVK
IKEFEELKKVPEMKHVERPLPEQWQKLEKSRDYRNGNQLREYQLEGMNWLLFNWYNRKNC
ILADEMGLGKTIQSITFLYEIFLMGLRGPFLIIAPLSTITNWEREFRTWTEMNVIVYHGS
QISRQMILQYEMYHRDEQGNIMSGEFKFQGVITTFEMIMADCPELKKINWRCVVIDEAHR
LKNRNCKLLEGLKLMNLEHKVLLTGTPLQNSVEELFSLLNFLEPSQFPSETTFLEEFGDL
KTEEQVKKLQAILKPMMLRRLKDDVEKNLAPKEETIIEVELTNIQKKYYRAILEKNFAFL
AKGANQHNMPNLINTMMELRKCCNHPYLITGAEEKILESFRKTYSSDAADFQLQAMIQAA
GKLVLIDKLLPKLLAGGHKVLVFSQMVRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAI
DRFSKVDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAV
KVYRLITRNSYEREMFDKASLKLGLDKAVLQDINRKGSLNGVQQLSKMEVEDLLRKGAYG
ALMDEEDEGSKFCEEDIDQILQRRTQTITIQSEGKGSTFAKASFVSSGNRTDISLDDPNF
WQKWAKIAELEIDSKAEKESLVIDTPRVRKQTRHYNSFEDDELMEFSELDSDSEERPCRT
RRLSDRNRRYLRAECFRVEKNLLIFGWGRWKDILNHGRFKWHLAERDMEVLCRALLVYCV
RHYKGDDKIKSFIWDLITPTEDGHNQALQNHSGLSAPVPRGRKGKKLKNQLSPPELKNAD
WLAHCNPEVVLQDDSYKKHLKQHCNKVLLRVRMLYYLKVEVLGDAATQALEGIPSSKLEV
TLPDIDYIEIPTIWWDAEADKSLLIGVHKHGYERYNAMRADPALCFLERVGMPDVTALTV
EQSGAETPSDAPDGISKSDEIKEENHVKSEELEEKVEIKEEPMSDETAKNDNMVTGCFVA
SLAGDLTAELMEQGRIQWPAGSALTARLRRLITAYQRYTRREPLRHDFLLHEGIAPVAWQ
IGEFRHCTTEPDPLFLEWQRRWTRREQADFYRTVSSFGVVYDPEKKNFDWSQFRALARLE
RKTDESLERYFHSFVSMCRTACRLPPRKDEGNVDPSLFVDPITEERAARTLYRIELLRKV
REQVLRHPLLGARLQLCRPSLYLPVWWECGKHDRDLLIGVAKHGLSRTDFYILNDPQLSF
LEAHRNYVHKENHRYPVPGLPHHHCCLYDANIGHCQSPQPPEYHPTPAHHTPTQLVHTHG
HHQSSEASEPGSSLGIGSGNREGFLDCPPLDDSLELGSLQHEGLTSDTLHGKSGKEAFNG
FPFNSATGGQNMLNSYGVQGELNGTQGDMADSIAGKLRSDVLVGEQGSSEETGLMAPSVE
LDELQTPWESSDHAETSDMFNEADPILGAQALEPSFLDAPQPDDGQEGDETLTDCLSMPS
SDSQSNPVEPLAPSFMLFKDLNVGETSVDQTDLSASLPEYVPPPPLGLPDVSLDQADPLN
EEQEDKLSDSNITPCVPSPEEEAESMGFNFEKEDLSPDSQKTKDTQDDMPSIESPSENCL
DESQKEDCKVPFDDSIERDLKDPCEMALEEPYEKPLREPEKVPLEESYDLTCDETLQEPC
DGFQQDAVEQQLMEKPSGETCKEPSDSIENCNLTNTTLSADYPLPPSLPSSPTTLPDTSV
SPVLDVVPKQEFLMDPMVSEVKPEPDSTTQTPHLEQTEALEIKDKIKDESAKTPVLLGDV
DSPRFALPICEMADSVHEIREPTIAQLLQEKALFSFSEWPKDRVIINRIDSICHTILKGK
WPSSSQQFESPTSLANTCVPSSAHQRAGFLPNRMPISQSLNFNLSHTVPHIQKQERLVTP
TFIPELKRPRRGFEFEAEVLAKPSHLGDKIQVGVSHRANALLINGWQDAAIDLSKPAELT
VGGDSGPIGHMSHTVQSAAHKITGIGSIQGSLGLDMAGILQAGLIHPVTGQIVNGSLRRD
DSMLRRRRGRRRNVETADLSFIKGRSINLPEQQSGAESISHPVVSSTSSQSECPPATPTT
LSSHSATPSPAAAAATETLSASVDRETANKGLMEWLRQNPNYNMELSAFPASQNAGMLHS
FLDRPKQRRHRCKDPSKLDVNSLTGEERVPVVHRNTGRRLGGAMAPAIKELSRWLDANSE
YSVAPDWADVVKHSGFLPEGKFTRILSGPVSRDPGPRRRGRRPRTEMPKAPELPAGMGSL
FMNGGLIGSMDLVSLPNLRNVPGIPLTGIMGFPHGFATAVSSDDAKNGLSMLPMMLHGMA
TVQPPMYSAHMSGMISQPMSTATSTMSTVTASSTTASVTLTNSATVTSTSVDSSDTAPPQ
DNASSPVSSEKGNKEDAKQGGEDKKTSASVSTAAATSSSNSSSITSTGSHLTFNPFLIPG
MSHSLLYPHMFLPPGSIMALPAMPAADSTGSPKRKRKKVREEGLVEGSGILGTQIDGEES
KGVKDEQTPELKSQEARVEENGPDVDLAPTNLIKAPSEDKRTEENEKTEQDAQGD
Download sequence
Identical sequences X1WCW5
XP_009300978.1.45394 ENSDARP00000128062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]