SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000129122 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000129122
Domain Number 1 Region: 65-235
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0062
Further Details:      
 
Domain Number 2 Region: 215-329
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-28
Family Ypt/Rab-GAP domain of gyp1p 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000129122
Domain Number - Region: 437-504
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.058
Family DNA polymerase beta-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000129122   Gene: ENSDARG00000077666   Transcript: ENSDART00000154712
Sequence length 566
Comment pep:putative chromosome:Zv9:2:10501015:10527032:1 gene:ENSDARG00000077666 transcript:ENSDART00000154712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLTVSSLSSTPGSELSTDEMKLLAKLEEQNRLLETDSKSLYSVNGVLRNPTSPKTFSL
EENIWENVINEWEDWSKRKVGQIKVLTRRGVPAHLRAMVWQLLCDSGNVSVRPQYSDLLK
SSSPSETLIHRDLTRTFPHHQLFHNHQSISKETLFNVLKAYSVLDQEIGYCKGSVFIVGL
LLTQMAEEEAFCVFVRLMKDFRMRELYKSSRDELGCCIYQFDSMIKEQLPELHSHFQTQG
FQTSVFSSSWFYSIFLSSLPISAAMRIFDIFMCEGLEIVFRVGLAVLDMKQTELIKLDNE
GMMKCLQNLESWESNPDLMIEAAYQIKYNGSQMKQFRKDYEAIKAKELEEQEELKGLCSE
NKHLKHRLAILERRCSEKLVSQLRKELEKTQLNIASSQNALKEMQANTSQLEEISAAPDE
HSVLYLRTELISCRLREAEALTELKQLKNHIKDMDEKLQQVLCGGQQRVSSTQNDLQVEL
LSTRLKETLTQAILKESRHALMQLQTQNEIHRNQLKRTEAHVSSQRDHLQELTSHNKDLH
SQLQQIRCHFLAVQNKVTPYLTSSAF
Download sequence
Identical sequences X1WFW7
ENSDARP00000129122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]