SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000129350 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000129350
Domain Number 1 Region: 69-178
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.56e-16
Family Protein kinases, catalytic subunit 0.000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000129350   Gene: ENSDARG00000096880   Transcript: ENSDART00000154090
Sequence length 179
Comment pep:putative chromosome:Zv9:6:16877682:16878991:1 gene:ENSDARG00000096880 transcript:ENSDART00000154090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHMGEERGEDTRDGTTELPGFLAPLPSHLADSASTDQRNSKRKRQSSSQQTASTSSSRP
AKRSRRDLYLKGPLLGRGGFGSVFAGMRRSDGLPVAIKYVSKDRTPERLKVDGLGRLPLE
VALMTRVASAPACPSVLQLLDWFDRPRRYILILERPDPCQDLQSFCEENGCLDERLAKK
Download sequence
Identical sequences X1WGJ4
ENSDARP00000129350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]