SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000129580 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000129580
Domain Number 1 Region: 2-40
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000495
Family Chromo domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000129580   Gene: ENSDARG00000097543   Transcript: ENSDART00000156655
Sequence length 266
Comment pep:putative chromosome:Zv9:3:24750140:24755398:1 gene:ENSDARG00000097543 transcript:ENSDART00000156655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYLVKWKGWAIKYSTWEPEENILDERLVAAFEQKEREQEMYGPKKRGPKPKTLLLKSRA
QAESPRVPEFKHSRPQPHSKPPPPPPPAAPSYTPTAPSNAKLQSGTAQPKLKKDIHRCHR
MARRPLPRQDHTVGPSGPFSSRPTVSAFSETVRILNRKVKPREVKKGRVILNLKVLDKAE
NTAVANNKRTHVPSTQQSHFGRQKIPSRNRVIGKNRRFGEVSYRGIQPPIRGSGFPVFGK
LFDSHSLKNAESGESRNSMTNNLSSS
Download sequence
Identical sequences ENSDARP00000129580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]