SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000001315 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000001315
Domain Number 1 Region: 215-296
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.31e-27
Family PHD domain 0.00054
Further Details:      
 
Domain Number 2 Region: 362-395,423-696
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 5.36e-19
Family Hect, E3 ligase catalytic domain 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000001315
Domain Number - Region: 147-203
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00237
Family PHD domain 0.013
Further Details:      
 
Domain Number - Region: 82-112
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0672
Family PHD domain 0.048
Further Details:      
 
Domain Number - Region: 9-53
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0971
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000001315   Gene: ENSDARG00000001313   Transcript: ENSDART00000001444
Sequence length 706
Comment pep:novel chromosome:Zv9:17:28857835:28870857:-1 gene:ENSDARG00000001313 transcript:ENSDART00000001444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALNEKSAEIKLQDRDLICCLCKRSENNKEKYGEKVHLEQHNLAVHFFCLLMSSGICQR
GEEDEDVYGFLVGDIKKEIRRSSRLRCFHCKKAGASVGCSIKSCRQMVHMPCGLEQEFVF
QFTGLFPSFCKKHAPTQSCDSSHSLPHSCSICLDPIEPILSYHVLKCPACHGSWFHRKCV
QNYAHSAAMFFFKCTLCNNKEQFQQEMLRMGIYIPERDASWELEENAFVELLQVYHRCDA
VKCLCHKGREHSSQSGYFEIVLCKLCGSRGTHRKCSNIRVYEADWMCADCKTAAEGKTSL
PLPNHVESPLAIRQERKRLFKSISDIHSSIVAKRQCVPATSPEVLMDLACQISQQQFTEV
LVGDDDGGVMEAALQVLRQSDFNPCCTLSVKFSKDKLNNNIRNQRRFLRRLVSKLQVSDI
FEGSDGAKNLALNSKALRDDLYFDVGSLLALSLVHGGPPLGFFSPALYHSLFNYPKNYRP
TLEDLGDTAFGHKIRQIAEAKSMKELRHAMKSASQYLEAAGCWRKISKLSEKDMLVEDVL
NFYLIIRLQLPLQRFREGLRTLGMFEQVQMCSETFFPVFCGPVERLTAESVMELFTTRLS
EEKEKQVLEKTTISFWKQYLHECEEGQCAASLEDLLTFATGTDLVPAIGFKPTPSISFLS
SPDNLCAFPQSNCDANHLILPTLPSYQLFKKHLDYTVCQFSVMQDI
Download sequence
Identical sequences Q8AW58
ENSDARP00000001315 ENSDARP00000001315 NP_001003822.1.45394 7955.ENSDARP00000001315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]