SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000001478 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000001478
Domain Number 1 Region: 389-479
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.46e-19
Family PLC-like (P variant) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000001478   Gene: ENSDARG00000001572   Transcript: ENSDART00000001821
Sequence length 555
Comment pep:known chromosome:Zv9:19:5883748:5888720:-1 gene:ENSDARG00000001572 transcript:ENSDART00000001821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLLLLFSLPFAFGCESVASTECEKLPFVPGHNLVGEGFNIVQMKTTGAFVVDVRNYMS
GGDHGNCTACDNKLLNQKQKLPVSVIDWRIKVQCRRSLSAKVYESASSVMEDTTSAASLS
WKVGLSVPMVAGVAVGGTHSKSARFARSHASKDKFSYTSHTFSCRYYSFRLHARPPLTKE
FAGSISSLPAKFDSTSESAYNHFISIYGTHFLRRVDLGGRVKSTTAVRTCQVSMKGLSAN
DVSNCLSAEASAIIKGVKVSGQTAYCKSKQKQLERANSFSATFSDRVTDILGGNGEQQDI
LFTPSNVSGYGKWLGSLKKIPGVVSYTLSSLHMLVRNDSARRSSLQQAISKYITKYAIST
ACPRNCKVGKRERNCACKCNGHVNVNSNCCPNKPGVATLTVTVVSAAGLWGDVFSKTDGY
VKVFYGSHTAQTPVIWNNNFPQWNFRAEFGTVDLTKKASLQFQVWDRDNGFDDDLLGKGA
VVPEKGVNVPKRFGFKHGSLMISYSATCGPSLQGSFCEIYAPTPGGDGVLNYYNPFGTER
PVFFKTDSKRDMSFL
Download sequence
Identical sequences F1R8E0
ENSDARP00000001478 ENSDARP00000119684 ENSDARP00000001478 NP_001304696.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]