SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000001617 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000001617
Domain Number 1 Region: 244-363
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.78e-30
Family Synaptotagmin-like (S variant) 0.02
Further Details:      
 
Domain Number 2 Region: 558-675
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-28
Family PLC-like (P variant) 0.0000663
Further Details:      
 
Domain Number 3 Region: 409-522
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.4e-16
Family Synaptotagmin-like (S variant) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000001617   Gene: ENSDARG00000001414   Transcript: ENSDART00000001102
Sequence length 927
Comment pep:known chromosome:Zv9:18:23154438:23236812:1 gene:ENSDARG00000001414 transcript:ENSDART00000001102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPRKKMWSNLRERAKPVLNLKIGKKKKKTPLKYRRSMSVPDLRFNPRAMMALQDESSTP
SQASAFFDNTDGLGDIDDTASETSSVAFSERFSVADVPYVCSPAPSERSAPVDFPVSAET
DKRQRATTWYFEDSDSVTGVTPSSAELQMTAGHAERRPTESSDKLVAALGRARALDDMSI
SSEEKAWHTEHEPSSPLSMFVVGSAEYLDTPNETSDFDDLSEHERNISGGLTESQSAAGL
QKLQYLLTINLKEGRNLVVRDRSGTSDPFVKFKLDGKHIYKSKVVNKNLNPTWNESFSLP
VRDLDQTLHLKVYDRDLRSNDFMGSSSFPLSKLELDRMVLMTLSLEDPNSEESDMGVIII
EACLSIREEPAKRNKWLLRRKGSFNKGQPISQAQFGRFTKSQVWSGVYTVILVEGQDMPD
CGQGDVYVRFRLGDQRVRSKSLCIKANPQWRESFDFNQFQDAQENLVVEVCCKRGRKSEE
CWGVLDIDLSRLPVNQRQLYTYELDPQKGKLRFLVTLTPCSGASISDIQSAPLDNPNTFE
KMREQYRPMNILGDFKNVGFLQVKLIRATDLPSTDISGKSDPFCTLELGNSKLQTHTICK
TLNPEWRTALTFPIRDIHDVLVLTVYHEDGDKAPDFLGKVAIPLLTISNGQQITRMLKTN
NLSRANKGSITLELKVLYNPIKAGIKTFQPKETMFAEDNPKFNKKLLARNIYRVRKISMA
ILYTLQYIKSCFHWENTQRSITAFLIFVVAVWLWELFMLPLFLLLLIGWNYFHITPGMAS
YSQDLEHMSVAEDEDEDEKESEKRGLMEKIHMVQEIVLTVQSTLDEVACIGERVKNTFNW
SVPFLSLLACLVLLVATVGLYYIPLRYIVLLWGVNKFTKKLFNPYAIDNNEMLDFLKRVP
SDVQKVQYSELRAELGNQGPVKKKRGR
Download sequence
Identical sequences F1R4M9
XP_690870.6.45394 ENSDARP00000001617 ENSDARP00000001617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]