SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000003208 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000003208
Domain Number 1 Region: 257-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.6e-84
Family Protein kinases, catalytic subunit 0.000000000518
Further Details:      
 
Domain Number 2 Region: 143-290
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-40
Family SH2 domain 0.00000264
Further Details:      
 
Domain Number 3 Region: 68-194
Classification Level Classification E-value
Superfamily SH3-domain 1.21e-17
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000003208   Gene: ENSDARG00000011370   Transcript: ENSDART00000023320
Sequence length 536
Comment pep:known chromosome:Zv9:17:15345468:15369821:-1 gene:ENSDARG00000011370 transcript:ENSDART00000023320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEATKLTDERETSVSQHAGYRYGSDPTPQHYPSFGVTAIPNYNNFHAPVSQG
VTVFGGVNSSSHSGTLRSRGGTGVTLFVALYDYEARSEDDLSFRKGEKFQILNSTEGDWW
EARSLLQVEQDTYPNYVAPVDSIQAEDWYFGKLGRKDAERQLLSNGNPRGTFLIRESETT
KGAYSLSIQDWDETKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVHHYSARAAGLCCR
LIVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAVKTL
KPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRG
LKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVER
GYRMPCPQDCPSSLHELMLQCWKRDPEERPTFEYLQAFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences F1QHX3
ENSDARP00000003208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]