SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000003721 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000003721
Domain Number 1 Region: 360-724
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.09e-125
Family Hect, E3 ligase catalytic domain 0.00000000549
Further Details:      
 
Domain Number 2 Region: 13-138
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.34e-22
Family PLC-like (P variant) 0.045
Further Details:      
 
Domain Number 3 Region: 275-314
Classification Level Classification E-value
Superfamily WW domain 0.000000000000529
Family WW domain 0.00077
Further Details:      
 
Domain Number 4 Region: 230-268
Classification Level Classification E-value
Superfamily WW domain 0.00000000108
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000003721   Gene: ENSDARG00000016086   Transcript: ENSDART00000004923
Sequence length 731
Comment pep:known chromosome:Zv9:3:40684994:40763330:-1 gene:ENSDARG00000016086 transcript:ENSDART00000004923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKVVVDGSGQCHSTDTVKSTLDP
KWNQHYDLYIGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCK
LNPSDSDAVRGQIVVSLQTRDRIGSGGPVVDCRGLVENEGPVFEDSGPGRPLSCFMEEPM
PYTDPTGAAGGGNCRALESPNQEQRLQAQRIRNQDSRGHTHTPQNRPHGHQSPDLPEGYE
QRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVSCEELGPLPPGWEIRSTVSGRIYFVDH
NNRTTQFTDPRLHHIMSQHSQVKESSQALPVQMEVGMEEGDGELPVRYERDLVQKLKVLR
HELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVARE
WLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYI
NGGFTLPFYKQLLGKPIQLCDLETVDPELHKSLVWILENDITSVLDHTFCVEHNAFGKFL
QHELKPNGKNIPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDNK
ELELIIGGLGKIDLNDWKANTRLKHCVADSNIVKWFWQAVESFDEERRGRLLQFVTGSTR
VPLQGFKALQGSTGSAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLT
AVEETCGFAVE
Download sequence
Identical sequences F1QEG9
7955.ENSDARP00000003721 ENSDARP00000003721 ENSDARP00000003721 ENSDARP00000111954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]