SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000005383 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000005383
Domain Number 1 Region: 861-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000112
Family Laminin-type module 0.0032
Further Details:      
 
Domain Number 2 Region: 331-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000123
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 3 Region: 922-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000209
Family Laminin-type module 0.045
Further Details:      
 
Domain Number 4 Region: 267-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 5 Region: 970-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.0027
Further Details:      
 
Domain Number 6 Region: 815-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000153
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 7 Region: 767-808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 8 Region: 409-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 9 Region: 454-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000865
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 506-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 11 Region: 1434-1652
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000000366
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 
Domain Number 12 Region: 1079-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 13 Region: 1127-1174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 14 Region: 1022-1076
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family Laminin-type module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000005383
Domain Number - Region: 104-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00435
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.046
Further Details:      
 
Domain Number - Region: 1185-1305
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00654
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000005383   Gene: ENSDARG00000002084   Transcript: ENSDART00000012166
Sequence length 1782
Comment pep:known chromosome:Zv9:23:20468083:20546771:-1 gene:ENSDARG00000002084 transcript:ENSDART00000012166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLSICVLSAVSAQEPDAAHGCTHGSCYPATGDLLVGREANLKASSTCGLRRREPY
CIVSHLQEEKKCFQCDSRRPYDPQSNPVSHRIENVITTFKPHRKKSWWQSENGKSDVYLQ
LDLEAEFHFTHLIMTFKTFRPAAMLIERSADFGRSWQVYRYFANDCESIFPGISQDSLRK
VDDVICESRYSDIEPSTEGEVIFRVLDPAIRIEDPYSPRIQNQLKITNLRLNLTKLHTLG
DNLLDSRPEIKEKYYYAMYELVVRGNCFCYGHASECAPIEGIRDDIEGMVHGRCVCKHNT
KGLNCEQCDDFYNDLPWRPAEGRNTNACKKCNCNGHSNQCHFDMAVYLATGNISGGVCDN
CLHNTMGSNCESCKPFYYQDPTRDIRDPGVCVACDCDPDGSKNGGVCDGHDDPSLGMIAG
QCRCKDNVEGSRCDKCKPGFFGLSASDPRGCQPCKCDPRGTVSGSSQCDPVSGDCFCKRL
VTGHSCNQCLPEHWALSHDTSGCRGCDCDVGGATENQCSMETGQCQCRSHMIGRQCNQVE
SGYFFMALDHYIYEAETAKLGQGSVFEEREYQPGRPISWTGTGFARAPEGGTLEFAINNI
PYSMEYDVLIRYELQMPRDWEEVRVVVIRPGPIPTSSPCGNTIPADDLLTVSLSSGARFV
VLPQPVCLESGVSYKLRVELIRYADRNSIITSTNAFVLVDSIALLPRYLSLEMFTAGDPA
SVARKQSFERYRCHETAKSVSRPQMSEVCAKLITSMSALINDGALACECDPQGSLSSECD
VRGGQCRCRPNISGRRCEKCAPGAYGFGPSGCKLCECSLEGSQSRFCDLYSGQCPCRPGA
YGQRCDGCQAGHWGFPNCRPCQCNGHADECHQRTGACLNCRSNTAGDKCERCANGYYGNP
VLGLGSQCRPCPCPEGPNSGRHFAASCYQDNRSQQVVCNCNQGYTGPRCDECAPGYFGDP
SKPGGQCQPCRCSNNIDLSDPESCDKRTGQCLKCLYNTEGPDCSVCRSGYYGDASRRNCR
KCTCNFLGTERSQCLSRDDCVCQRATGQCQCLPNVIGQTCDHCAPNSWNLASGQGCEPCA
CDPNNAYTSACNEFTGQCQCRVGFGGKTCTDCQENHWGDPRVLCRACDCDPRGIESSQCN
RMTGHCVCQQGVSGVRCDQCARGFSGTFPDCKPCHQCFGDWDRIVQDLATRTKALTDRAK
ELQTTGLTRAFERRFKELEDMLAQARDIVNARNATAEAVTTLMGMIEVLRAQIGETTDTL
NQQEGDLTAVQDSNYEASNALSTLEREAKELNLNADQLNRQLDILKNSNFLGAYDSIRAS
YNKSRDAEHRSNRSTTDTPSTVSQSADTRKKTERLIGQKRDDFNRKNAANKRTLTDLNAK
VQNLDLKKINEKVCGAPGDAQCVDSPCGGAGCRDDEGKRRCGGLNCNGAVAVADTALDRS
KHAEKELDKAMGVVEELFKQVADAKTKAQEAKDRAQAALEKASDTKNKVDHSNNDLRDLI
KQIRQFLMQEGADPDSIEAVANRVLELSIPASPKQIRHLADEIKDRVKSLSNVDAILEQT
QNDVRKAEQLLLDAKKARNKAEGVKNTAESVKKALNDASRAQAAAEKAIQKAKNDIGLTQ
NQLAQIQSETSASERDLNDAVDRLGDLERQIEALKTKRANNSLDAARAEETATMARDKAN
EAKEILDGELSDKYRTVQGLMDNKAKTMQDAKHKAEQLRDEAKGLLKDAQDKLQRLAELE
KDYEENQKVLEGKARQLDGLEDKMKAILNAINRQIQIYNTCQ
Download sequence
Identical sequences B7ZDA6
ENSDARP00000005383 ENSDARP00000123269 ENSDARP00000005383 NP_001229974.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]