SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000005975 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000005975
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.44e-72
Family BAR domain 0.0000000427
Further Details:      
 
Domain Number 2 Region: 288-349
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000005975   Gene: ENSDARG00000013360   Transcript: ENSDART00000023301
Sequence length 352
Comment pep:known chromosome:Zv9:7:13670626:13733309:-1 gene:ENSDARG00000013360 transcript:ENSDART00000023301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGFKKQLHKASQLLSEKISGAEGTKLDEDFMEMERKIEVTNKSVFELITKTTEYLQP
NPASRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLRYGRELGEESAFGTALADIGEA
MKQMADIKDALDISVKQNFIDPLQNLQDKDLKEIVHHLKKLEGRRLDFDYKKKRQGKIPD
EEIKQAVEKFEESKELAERSMFNFLENDVRHVSQRXALIEAALEYHRQSLEILKDLDSKL
QNRISTASRRPKKEFKPKSIVSSLESVENTQHNGLSHTSSIKSTELESHMDQPCCRSLYD
FEPENEGELGFKEGDIIILTNQIDENWYEGMINGESGFFPINYVDVLVPLPQ
Download sequence
Identical sequences F1QVP1
ENSDARP00000005975 ENSDARP00000005975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]