SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000006941 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000006941
Domain Number 1 Region: 27-104
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000366
Family F-box domain 0.0086
Further Details:      
 
Domain Number 2 Region: 186-356,383-464
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000279
Family Cyclin A/CDK2-associated p19, Skp2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000006941   Gene: ENSDARG00000006924   Transcript: ENSDART00000020625
Sequence length 1120
Comment pep:known chromosome:Zv9:14:40047604:40079843:1 gene:ENSDARG00000006924 transcript:ENSDART00000020625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSPRRKVTRTHSLGGGTLSSLGHEEPKDYINELSHEVLCHIFRYLPMQDIMCMECLSRK
LREAVTLYLRVVKVVDLCASRWWEYMPSGFTDSSFLMLMKKMPDLEQLYGLHPRYLERRR
VRGYEAFSIPGVLEALQACPNLIGVETSHLELVEAVWNYMPQVHILGKFRNRNGAFPIPS
ENKLTIPAAAKIQTLHLVGVNVPEIPCLSMLRHLYLKWVRLTKPQPFKDFLCVNLRTFVM
RNCAGPTNSLKYVPLVTGLASARNLEQLELVRVPFLGGLIQHVVEDSWRSGGFRNLHTIV
FGACKNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSALKMAELEFPQFETLHLGYVD
EFLLQCNMSHAELVKYGLADVIENPGIITDIGMKAVNEVFTSIKYLVIYNCPHLHNPHNW
ITDHSRWSRLVDLTLVRCHAIKLESFSQFIELLPSLEFISLDQMFREPPKGCARVGLSAG
TGIGVSSALVSNQNSNNDNDNNNNNNHQNNNDANIPPNNNDNQVENVPQQNHRGPEAEIP
VVEGMVAENIEPEPVLVAANPQEENQSSSQTPNPSLEQDEEQAGPSGVQTSVKKPSVVVS
DSDSEDEYSPVRTPAAARSQGQYPETEAQGKSSTAGTPHGKGKTPLRRRGPQPQELSCEK
GCQVTSEQIKADMKAATETAERGAKDRNSGSAPASNYSAGSCVCSIRWREDSANQDDQGG
AGDMVRTRCTCNRSRSSSENRTRSGHGLPTGGDNHRAEEMEDRHSNASARTPSSFEGHNN
RTAGHSSHRGPTDEFPRRPITRARSRLSSVPLVCESELPKAKPRTAVKRKRMADKSTSTS
DPVTEDDHVQVLSLKSKNLVGITLTNCGITDLVLKECPKMMFVHATRCRVLKHLVVESAP
IVNRFDYAQCKKLDMEQVLDQILRMPPERNRIIYMRPMQQIDSLALEKKLFSGPYPYHIA
IIHEFSNPPNVRNKVRVRSWMDTIANISQELIKYEFFPEATRTEEDVKKYPSYPWGRDIY
TLEGVVDGAPYSMITDFPWLRSLRTAEPNTYARYDFEDDESTTIYAPRRKGQLSADICME
TIGEEISERRQTCKGVFQRVVVVFIHYCDVRGEPVEDDYI
Download sequence
Identical sequences E7F2P7
ENSDARP00000006941 XP_001339486.2.45394 ENSDARP00000006941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]