SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000009659 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000009659
Domain Number 1 Region: 269-538
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-81
Family Protein kinases, catalytic subunit 0.000000000299
Further Details:      
 
Domain Number 2 Region: 156-300
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-40
Family SH2 domain 0.00000632
Further Details:      
 
Domain Number 3 Region: 81-207
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-29
Family SH3-domain 0.0000734
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000009659   Gene: ENSDARG00000005941   Transcript: ENSDART00000027090
Sequence length 546
Comment pep:known chromosome:Zv9:2:31024309:31079129:1 gene:ENSDARG00000005941 transcript:ENSDART00000027090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVKSKEDKGPTQKYRPDPTNPTPGSHMGLYGPDPTQMGQSPALKGPTNNYNSRSSGLT
PFGGSSSVITPFGGASSSFSTVAVNNPFPGVVTGGVTFFVALYDYEARTSDDLSFSKGDR
FQIINNTEGDWWEARSINTGQKGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLLPGN
QRGTFLVRESETTKGAYSLSIRDWDEMKGDNVKHYKIRKLDSGGYYITTRAQFDTLQKLV
KHYTEHADGLCYRLTTVCPTVKPQTQGLAKDAWEIPRESLRLELKLGQGCFGEVWMGTWN
GTTKVAIKTLKPGTMSPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEYMGKGSLL
DFLKEGEGKYLKLPQLVDMAAQIADGMAFIERMNYIHRDLRAANILVGDNLVCKIADFGL
ARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMV
NREVLEQVERGYRMPCPQGCPESLHEMMRLCWKKEPDERPTFEYIQSFLEDYFTATEPQY
QPGDNL
Download sequence
Identical sequences A1A5H8
7955.ENSDARP00000009659 NP_001013288.2.45394 ENSDARP00000009659 ENSDARP00000009659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]