SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000016655 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000016655
Domain Number 1 Region: 327-454,773-950
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.94e-52
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 59-181
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-29
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 1150-1216
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.14e-18
Family SAM (sterile alpha motif) domain 0.0041
Further Details:      
 
Domain Number 4 Region: 227-296
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.97e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000386
Further Details:      
 
Domain Number 5 Region: 167-223
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000434
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000016655   Gene: ENSDARG00000018716   Transcript: ENSDART00000013111
Sequence length 1223
Comment pep:novel chromosome:Zv9:9:18304082:18468435:1 gene:ENSDARG00000018716 transcript:ENSDART00000013111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPPQEPEKAAASASGVPAVGAVGGSGPVVDESSDSEGEQEGPQKLIRKVSTSGQIRSKTS
VKEGLLLKQTSSFQRWKKRYFKLRGRTLYYAKDAKSLIFDEVDLSDASVAESSTKNINNS
FTVITPFRRLILCAENRKEMEDWISSLKSVQSREHYETAQFNVEHFSGMHNWYACSHARP
TFCNVCRDSLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGIAM
PHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWRCLWCKAMVHTACMDLYPRKCPLGQCKVS
IIPPTALNSIDSDGFWKATCPPSCASPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDL
VNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLHKQCQLGVLPLGTGNDLAR
VLGWGPSCDDDTQLPQILEKLERASTKMLDRWSIMTYEIKIPPKHSCPATPEEAEDGQLQ
ISAYEDSVAAHLTKILNSDQHSVVISSSKVLCETVKEFVSRVGKCYERGSDSSEESDALA
LKCAMLNEKLESLLQTLNLEAQVLSPTALTTPPIVEEEVEEEELEEEDEDLSEESLTELK
ENETEKGSAHKLFRPREQLVLRANSLKKALRQIIEQAERMVDEQNAHTEEQELQSPSDFR
KDSEEENKDNEKDEDTKELETLPLAKSPCSPPERRISRSTQSCGSFSITPFTTSKENLPV
LNTRIICPGLRAGLAASIAGSSIISKMLLANIDPFGATPFIDPDLDSLEGYLEKCVMNNY
FGIGLDAKISLEFNNKREEHPEKCRSRTKNMMWYGVLGTKELLQRTYKNLEQKVQLECDG
QYIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFCAPSFDDKILEVVAVFGSMQMAVSR
VIKLQHHRIAQCRTVKITILGDEGVPVQVDGEAWIQPAGVIKIQHKNRAQMLTRDRAFEN
TLKSWEDKLKYDKPPLRPHLYPQQSVDLATEEEATLIQMCARAAEDLITRICEAAKNYQL
LEQELAHAVNASSHAINKTHPKFPESLTRNTAIEVASTVKALHNETESLLVGRVPLQLDP
PHEDLLSTALQNVEVELGKLVEIPWLYHILQPNDEEDPSLEYGKRNSRSGMFRIVPKFKK
EKVPKKSSPQSVQRWGTEEVAIWLEQLSLGEYKDTFIRHDIRGSELLHLERRDLKDLGIS
KVGHMKRILQGTKDLAKSSMVDL
Download sequence
Identical sequences F1RC67
ENSDARP00000016655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]