SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000017728 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000017728
Domain Number 1 Region: 79-90,177-417
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-52
Family Nuclear receptor ligand-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 7-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-27
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000017728   Gene: ENSDARG00000018030   Transcript: ENSDART00000006409
Sequence length 443
Comment pep:known chromosome:Zv9:8:54781787:54803342:1 gene:ENSDARG00000018030 transcript:ENSDART00000006409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDQAEQRSCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCEMSRKQRNR
CQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISDEEIERIMSGQEFKDEANMPEH
TWGNNGDSDHSSPGNGVSDGNQPSPVSTLSSNRSVELNGYTTALREQYIGNAMAQHYQFL
PHLFGYAAQPRSLYPQSHTLISQLVAAEDLAPLGTPMLIEDGYRVTQVELFALLCRLADE
LLFRQISWIKKLPFFCDLSIEDYTRLLSATWQELILLACLTVYSAQVLGDLANVTHKYTP
SDDELHSFSEDGMEVMEKLIYLFRKFHQLKVSNEEYACMKAINFLNQDIRGLTNVTQLEQ
LNKRYWYVCQDYTEYKYPHQPKRFPEIMMCLPEIRCIAGKLVNIPLEQLPLLFKAVLHSC
KSSLSSYRTSSSPCVTKGTAPAN
Download sequence
Identical sequences A0A0R4ILU7
ENSDARP00000017728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]