SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000018632 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000018632
Domain Number 1 Region: 17-250
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.7e-68
Family BAR domain 0.00039
Further Details:      
 
Domain Number 2 Region: 302-359
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000347
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000018632   Gene: ENSDARG00000045294   Transcript: ENSDART00000018095
Sequence length 360
Comment pep:known chromosome:Zv9:24:29305847:29320410:1 gene:ENSDARG00000045294 transcript:ENSDART00000018095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNVKRFAADAGTLFSRAVQFTEEKFGQAEKTELDAHLETLLTRAECTKHWTEKILKQT
EVLLQPNPNARIEELLYEKLDKKAPPRMNNHELMGQSMIDSGNEFGPGTAYGNALIKCGE
TEKQIGGAEREFIQTSAINFLTPFRNFLEGDFKTILKERKLLQNKRLDLDAAKTKLKKAK
MADARAVAEQDLKMTQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQ
YMVDLQKQLGNFPSAFTSNNNQSTASGGAGVSVPILPLSTPLPSTTSNTSSGFTEMQNFS
GSRKARVLYDYDAAGSNELSLLADEVIMVSSVPGMDSDWLMGERGSQKGKVPITYLELLN
Download sequence
Identical sequences F1QGH8
ENSDARP00000018632 ENSDARP00000018632 7955.ENSDARP00000018632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]