SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000020759 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000020759
Domain Number 1 Region: 191-315
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 3.14e-61
Family Dystroglycan, domain 2 0.00000135
Further Details:      
 
Domain Number 2 Region: 472-570
Classification Level Classification E-value
Superfamily Cadherin-like 6.36e-17
Family Dystroglycan, N-terminal domain 0.02
Further Details:      
 
Domain Number 3 Region: 78-168
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000455
Family Dystroglycan, N-terminal domain 0.0000998
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000020759   Gene: ENSDARG00000016153   Transcript: ENSDART00000004504
Sequence length 866
Comment pep:known chromosome:Zv9:22:36015344:36073174:1 gene:ENSDARG00000016153 transcript:ENSDART00000004504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNKLREFRDGGRPMLGQWDRTLVVLLMALALTVTDVRASWDQMEVLGDVKLEASMHSAV
LSDIREAEAVVAAVSQPSGFPDSSAVVGRVFRLQVPIKAKDSGSIVKITEASKDVLPAWL
HWDAESGTLQGLPLETDKGVHYISVSVSNESKVSQSPDVFSIEVHPEEHAETDPFQLAIQ
QSASNDAQPFICGNEEPVTVLTVILDADLTKMSSKQRVELLAKMKKFSGMGLQHMKILPV
VNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLDQSSIPDISSVQVPAKEGTMSAQL
GYPVVGWHIANKKPHVPKRVRRQLNNTPTPIPSLLPPTTYPEPPIRIVPTPTSPSIAPTS
ESSAPPVRGPVPLPVKPTIRNRDSAPSTPTLGPPLPTRVMVTTSTIAIQPTMTRPVYVGA
SVTPATPTTRKPTKRPPKKPKTTPIPREPKTTTTKPPRRSTPAVIGDSNIKPELRNPIDQ
VNAYVGTYFEVKVPSDTFFDKEDGTTDKLRLTLRKGNDVVADDSWIQFNSTSQLLYGLPD
QEHAGKHEYFMQATDKGGLYAMDAFEVRVSMWGNSVKPPVLFTAVFDGDARTVTNDIHKK
ILLVKKLSQSFGDRNSSTITLKSITKGSIIVEWTNNSLQQSPCPKDQIQQLSKKISDPEG
KPSSIFKFTMEPDFRPSNITVRGTASCRNYMFVPLGEIPDPTPSPGTPAVGAGRQSTDDV
YLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTIEDQATFIKKGVPIIFADELDDSKP
PPSSSMPLILQEEKPPLPPPEYPNMATPETTPLNQDLLGEYTPLHDEDPNAPPYQPPPPF
STPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences F1QMH7
ENSDARP00000020759 7955.ENSDARP00000020759 XP_005170601.1.45394 XP_009294762.1.45394 ENSDARP00000020759 ENSDARP00000106371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]