SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000023917 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000023917
Domain Number 1 Region: 46-121
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000707
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 136-178
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000209
Family Hairy Orange domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000023917   Gene: ENSDARG00000004060   Transcript: ENSDART00000026017
Sequence length 403
Comment pep:known chromosome:Zv9:11:36600441:36604112:-1 gene:ENSDARG00000004060 transcript:ENSDART00000026017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERITSAQPPPCMSKHPSLDISDMQGMDFPMYVYKPRRGMKRSEDSKDTYKLPHRLIEKK
RRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALNNLLEQQQQKIISLQN
GLQIGEQGNGPSENSEEMFRSGFHLCAKEVLQFLANQETMRDLTTAHIIEHLQKVASELI
QSPPSPRLDEPAPKAQESREKPSGLQPKAAEGHAKNCVPVIQRTYPHSSEQSGSDTDTDS
GYGGEYEKRDQKAQRPDCYVKESGALKYSSSIKEEQDEPPSKRPRSDSSEDESLSGHDVV
GGHSPYVSFSPPQPLCMPFYLFPPGAAAAYLPMLEKCWYPGAMPVLYPGLGSSPASLSPE
KLPSSMVMSSRVGSPVSTPTSMDSPALLQALKQVPPLNLETKD
Download sequence
Identical sequences Q6NY50
ENSDARP00000023917 ENSDARP00000107345 7955.ENSDARP00000023917 ENSDARP00000023917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]