SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000024987 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000024987
Domain Number 1 Region: 327-566
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.78e-67
Family Nuclear receptor ligand-binding domain 0.0000000382
Further Details:      
 
Domain Number 2 Region: 201-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-28
Family Nuclear receptor 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000024987   Gene: ENSDARG00000004111   Transcript: ENSDART00000024518
Sequence length 620
Comment pep:known chromosome:Zv9:20:26389363:26412068:-1 gene:ENSDARG00000004111 transcript:ENSDART00000024518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPACVFPVMSGGQTSGEAVGARQRRRTSPSPEREALEEPSSPPAAHKLSPMYPKEEHSA
GGISSSVNYLDGAYEYPNPTQTFGTSSPAEPASVGYYPAPPDPHEEHLQTLGGGSSSPLM
FAPSSPQLSPYLSHHGGHHTTPHQVSYYLDSSSSTVYRSSVVSSQQAAVGLCEELCSATD
RQELYTGSRAAGGFDSGKETRFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYVCP
ATNQCTIDRNRRKSCQACRLRKCYEVGMMKGGIRKDRGGRSVRRERRRSSNEDRDKSTSD
QCSRAGVRTTGPQDKRKKRSGGVVSTLCMSPDQVLLLLLGAEPPAVCSRQKHSRPYTEIT
MMSLLTNMADKELVHMIAWAKKVPGFQDLSLHDQVQLLESSWLEVLMIGLIWRSIHSPGK
LIFAQDLILDRSEGECVEGMAEIFDMLLATVARFRSLKLKLEEFVCLKAIILINSGAFSF
CSSPVEPLMDNFMVQCMLDNITDALIYCISKSGASLQLQSRRQAQLLLLLSHIRHMSNKG
MEHLYRMKCKNRVPLYDLLLEMLDAQRFQSSGKVQRVWSQSEKNPPSTPTTSSSSSNNSP
RGGAAAIQSNGACHSHSPDP
Download sequence
Identical sequences F1QL15
ENSDARP00000024987 ENSDARP00000024987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]