SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000025094 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000025094
Domain Number 1 Region: 323-448
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-29
Family PLC-like (P variant) 0.062
Further Details:      
 
Domain Number 2 Region: 750-878
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.16e-27
Family Synaptotagmin-like (S variant) 0.0037
Further Details:      
 
Domain Number 3 Region: 475-611
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.21e-21
Family PLC-like (P variant) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000025094   Gene: ENSDARG00000030824   Transcript: ENSDART00000009093
Sequence length 888
Comment pep:known chromosome:Zv9:2:42520962:42593319:-1 gene:ENSDARG00000030824 transcript:ENSDART00000009093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASVNGVEPKPAPAVSQNGPGSPPQTPKDVTPPELELPDEEPQSSVTEATQMGIKFAKT
FLLIFPIYLLGYLEFSFSWVLIGLGLVFWLKRNQGSRFARVNQAMAFLEQEERAVRQTIR
SSELPPWVHFPDVERVEWLNKTVQQMWPYICQFVEKIFKETIEPAVQGANTHLSTFTFSK
IDMGDKPLRVDGVKVYTENVDKRQIIMDLQINFVGNTEIDVDIKKYYCRAGIKSIQLNGV
LRVIMEPLLGDMPLVGALSVFFLKKPFLDINWTGLTNMLDIPGVNSLCDNVIQDIINGCL
VNPNKITIPLADDALISKLRFPMPRGILRVHFLEGQDLLSKDTYMGGLIKGKSDPYGVIQ
INNQLFRSKIIKDSLNPRWNEVYEAIVYDGQGQVVFIELFDEDTDHDDFLGSLTMEIDEI
QKQQKVDEWFDLIGVPNGKLHVKAEWLSLHPTPDKLDEVLSSIKADKGQANDGLSSALLL
VHLDSAKNLPRNPLEFNSAGLKKGAVNKAVKSGKKVTSVPNPFVQFTVGHRSFESKTRFK
TIEPVWEETFTFLIHNPKCQDLEVEVKDEKHECSLGTITLPLSQLLKEKQMTMSQRFPLK
NSGPGSTLKMKMALRILSLDKLAASDKPSSAQVHRAGSVRKTSNATPQRPAVSEPAKTSK
TQQPAPAPRTQPTPTPSPRVEPVTDRKPLEESPPHLAKSGKSMSNLAISGSNLHLNSKEQ
TPSIASDISNLAATQELQKTIQHLHNGASPGFAPLGEIELTIRHSPQRNKLIVVVHKCRN
LISASQNGSDPYVRLYLLPDKRRSGRRKTSTAKKTVNPVFDQTFEFTVSIVELQKRTLDV
AVKNGGGILAKHRGLLGKVIVEFNLEDPSKSSTQWYELSVDGFKRPSP
Download sequence
Identical sequences E7FF26
ENSDARP00000025094 ENSDARP00000025094 XP_698532.4.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]