SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000026889 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000026889
Domain Number 1 Region: 702-927
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-57
Family DBL homology domain (DH-domain) 0.000000265
Further Details:      
 
Domain Number 2 Region: 307-487
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.53e-45
Family Regulator of G-protein signaling, RGS 0.00000145
Further Details:      
 
Domain Number 3 Region: 931-1062
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-32
Family Pleckstrin-homology domain (PH domain) 0.0000219
Further Details:      
 
Domain Number 4 Region: 35-115
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-20
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000026889   Gene: ENSDARG00000052482   Transcript: ENSDART00000017140
Sequence length 1406
Comment pep:known chromosome:Zv9:7:6227373:6314923:-1 gene:ENSDARG00000052482 transcript:ENSDART00000017140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLSSLTLGDSERRSSPGQQRETLPDLSSDNTGTGLVQRCVVVQRDNLGFGFTVCGERIKL
VQNVRPGGAAVKAGVQEGDRIIKVNGSMVSSMSHQEVVKMIKSGTYVALTLQGPPPSVAS
TPLQPLPSDLLSNHRTAPGEAPPLPQTPPTGSSTPTQRITGPKPLQDPEVQKHATEILRK
MLEQEEAELQNLLEEQSRNPSVSLEERIERAKRRASQVRVKIQQDVDGTRSDAVANYLTA
GEGRLSIDSSEGDVEVCESPFSSPSSFLRNPLTHRRTSDTHTSDSGKMQIIGPEEEEEDD
GYTINEMDGPFQDIELLKSRPAHMTVFMRYVFGQLLDPNPLLFYLSVEAYLGSSPKDARS
LAPQICSHFLDHDAPLKIKVREEFLTDIENRLHAQEDIRGPLSELQQQVLPDIQDQLQDY
RNKQTMGLGSLFGESDLQQLDGDPVKEKQVVDKQIVALWEILSKHEEDRSSPLASAVHLY
LRHSGIKLRDSKVFPGLMSEKEKWLPFFPKAKKLSSAKRERDGEDKKRNPILKYIGKPRS
TSQSMHYSPFSVLAVRPGSVRNIIQQFESNSDSLEDGELEGQRLSGSFGEDSMESPTISV
RLARSESLKAQGEGRRRGGGTGAEFVPRSRSDVDMEDCEEREGPGLRPLHHSASSSASSS
SARSLENPTPPYTPRSQRRIVEVPVSLLPDAPALDEDVIDSHNWQDTVEPHILASLTSRE
IDRQAVIYELFTTEVSHLRTLRVLDQVFYQKMQSVLSPEELSCIFLNLRQVYELHASLCE
SMKKCRESVIVQGIGDIMLARFEGEAGDQFEEQVSHLCSQQSPALELIKNKQRKDPRFAH
LIQECEASPHCRRLQLKDLLVSEMQRLTKYPLLLDNIIKYTETSSPDLPLLRRAQACCRG
ILQEVNEDVRETEHRHLLSQYQRRLDATPLERLANPVAAQFRNLDLTTKRMVHEGPLTWR
VGKDKAIEIQALLLSDLLLLLQRGPDDRLILRCPSRSLGGVTDLKTPFCPVVCLNSCLVR
PVATDNKALYVISTSERQIYELVAGTLLEKNTWKDQLEKTISAAAQGGSTKPNTPRFRSP
GAGVRLSADQSEGSESRMYPDREDEMVLSPVVTPADAAEECPDEDPDAGQKNKAGVAESA
LQDVETLRQLIFRDLEDGWSQDSDDTPTNETANERSPFTDRPGNESSDPAPSESSSQWEE
EPVEAPPLEVLQPAVQVVRKAVGVGCSLPDDITDDVTASQSSEDGGNLFYLVMSTDQGVS
DESTTDELKDLHHSVFSSSFINEEEEQDTPCLSPTDQSLIESQGHRPGLSQSQSSVQRHV
IKNVDEIFNTMEELMKKLQHLRDIEADHHKLLKKLRKPLPVDKMSSDGVHKSPTAARLSS
LDRGAGDGKEGVSTEPAQPQIQSTGF
Download sequence
Identical sequences ENSDARP00000026889 ENSDARP00000026889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]