SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000027076 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000027076
Domain Number 1 Region: 12-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000419
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000027076
Domain Number - Region: 116-156
Classification Level Classification E-value
Superfamily Orange domain-like 0.000196
Family Hairy Orange domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000027076   Gene: ENSDARG00000014722   Transcript: ENSDART00000016307
Sequence length 328
Comment pep:known chromosome:Zv9:5:71693373:71699778:-1 gene:ENSDARG00000014722 transcript:ENSDART00000016307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTPKMASRRPTKRILKPVIEKKRRDRINQRLEELRTLLLDNTLDSRLQNPKLEKAEILE
LAVEYIRTKTATARDQGDSSKDTHDPKPPPLLSRRPQMPCASIPESIQTHNLPSNPIYKA
GFKECISRLASFIDCVEPSQRDSFVQGLCHHLDSYSSALPHGRVSSNPTHHPWIPNPELS
CRTDVQSIGHMRANPEPYSYANSLYPKSFMHLHPTGQHPYLSPPYSISPPPSPGFSSSSP
PFSSSPTYLSVPCQFPFPPSISPHSTDSSSSSSLSTVSLSTTSLPVVPGPHLQVSSPTRV
RFSGSVQSSQPRTLRRALFHNQPLWRPW
Download sequence
Identical sequences A3KQ56
ENSDARP00000027076 7955.ENSDARP00000027076 ENSDARP00000027076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]