SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000028698 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000028698
Domain Number 1 Region: 53-290,322-347
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.49e-66
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 560-709
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-65
Family Ankyrin repeat 0.00000269
Further Details:      
 
Domain Number 3 Region: 438-555
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.62e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.0000107
Further Details:      
 
Domain Number 4 Region: 323-425
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-20
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 5 Region: 1066-1155
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-18
Family SH3-domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000028698   Gene: ENSDARG00000039729   Transcript: ENSDART00000030409
Sequence length 1156
Comment pep:known chromosome:Zv9:24:10673654:10822960:-1 gene:ENSDARG00000039729 transcript:ENSDART00000030409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRSSSSRLSFSSKEPIWNRMPDQISVSEFLSETTEDYNSPTTSSFTTRLQSCRNTVSVL
EEALDQDRTSLQKVKKSVKAIYNSGQDHIQNEETYSQALDKFGSNFISRDNPDLGTAFVK
FSTLTKELSALLKNLLQNLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQVD
QKEDSQSKQGGYSMHQLQGNKEFGCEKKGYLLKKSDGLRKVWQRRKCSVKGGILTISHAT
SNRQPVKLNLLTCQVKPSAEDRKCFDLISHNRTYHFQAEDEQEFIIWISVLTNSKEEALN
MAFRGEQGGGDDGLEDLTKAIIDDVLRMPGNEWCCDCGAPDPKWLSTNLGILTCIECSGI
HREMGVHISRIQSMELDKLGTSELLLAKNVGNSSFNDIMEGGLSCPSSKPTPSSDMTVRK
EFINAKYVDHKFARKTCSSAEDKRSDLFKAVGSHDLLALIQVYAEGVELLEPLHEGGQEG
GETALHYAVRTADQTSLHLVDFLVQNSGNLDKQTERGNTALHYCCLYEKHECLKLLLRGK
PATDITNQNGDTALDVARRMKLFQCEEALVQAAAGKFNTKVHVEYEWNLRLEELDESDDD
LDYKPSPIKKDRSPRPQSFCHSSSLSPHDKLSLPAFIGQRDKQRLSYSAFTNQMYSVSTD
CPSSPVSDAPPLPPRNAGKAPSLAFLGSHSHYATLASTRPYITPPLSNLPPSTLAPASQT
SPSGSSTLSKKRPPPPPPGHKRTLSDPPTPLFKGSDSTPPPVNKMSPVTNRFEGIPQQQS
PNTTKPTLGPRVLPKLPQKVALRKIDTIHHPSVDKTNQPSEAVLFQKVLQSSDTSQKVPI
ADRPQPGDVAPQRPQPSELPPKPGELPPKPQLSELPPKPQLGDLPPKPQLKDLPPKPQLA
DISPAKPITIEVPPKPSPGEVAPKPQPPDTPTIIQQGELSPQPVIQSSEDTNGSPTSAQD
TPVPLPRKINPIKSKMRRVKTIYDCQADNDDELTFAEGEVIVVTGEEDQEWWIGHIEGQP
ERKGVFPMSFVHILSD
Download sequence
Identical sequences ENSDARP00000028698 ENSDARP00000028698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]