SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000029204 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000029204
Domain Number 1 Region: 83-94,292-497
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-61
Family Nuclear receptor ligand-binding domain 0.000000182
Further Details:      
 
Domain Number 2 Region: 11-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-29
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000029204   Gene: ENSDARG00000023362   Transcript: ENSDART00000028265
Sequence length 502
Comment pep:known chromosome:Zv9:21:7776899:7817498:1 gene:ENSDARG00000023362 transcript:ENSDART00000028265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYSYDADLEEMCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCAESQDCKIDKT
QRKRCPFCRFQKCLNVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRASGLKM
EATPPLLTSPQPDYTFSTALSVPAPKNTHPNIVTSVAPTDYERSLYASSSLSLSVPIPAH
TPLPAQYPYPNLPSRAIKSEYPDHYTSSEHYTSASSPESVPGYTYIEQTRVSSSPQVVAP
GLTVPPLVLEFVRCEQDELQVQSKISAHLAHLQQEQNSRSTAANQEQSSRLAAKPERLST
FGLMCHMADQTLFSIVEWARSCIFFKELKVGDQMKLLHNCWSELLVLDYVARQLHHGKED
SVLLITGQEVELASLLAQAGVTLSGMIQRGQELVQRLQELQLDRRETACLKYLILFNPDV
KLLENQPYVESVYEQVNAALLEYTLCAYPQFPDRFSQILLRLPELRALSSQAEDYLCYKH
LSGEVPCNNLLIEMLHAKRTCI
Download sequence
Identical sequences Q800U8
NP_997999.1.45394 7955.ENSDARP00000029204 ENSDARP00000029204 ENSDARP00000029204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]