SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000030606 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000030606
Domain Number 1 Region: 614-906
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-83
Family Protein kinases, catalytic subunit 0.000000000801
Further Details:      
 
Domain Number 2 Region: 31-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.08e-66
Family Ephrin receptor ligand binding domain 0.00000199
Further Details:      
 
Domain Number 3 Region: 327-526
Classification Level Classification E-value
Superfamily Fibronectin type III 3.77e-37
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 4 Region: 898-970
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.02e-19
Family SAM (sterile alpha motif) domain 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000030606
Domain Number - Region: 258-329,365-384
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000879
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000030606   Gene: ENSDARG00000011600   Transcript: ENSDART00000037292
Sequence length 976
Comment pep:known chromosome:Zv9:2:40081937:40266727:1 gene:ENSDARG00000011600 transcript:ENSDART00000037292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLWIYPSLLFFLFPSLTPSQALRNYPENEVKLLNNLRISAELFWEYPADGWWEEISVM
DERNTPMRSYQVCNVMEASQNNWLRTRHIAREGAQRVYIEIKFTLRDCNSLPGVPGTCKE
TFNMYYYESNNPNLWFIKESQYIKIDTIAADESFTQTDVGDRVMKLNTEIRDINNLSKKG
FYLAFQDVGACIALVSLRVFYKKCPLAVLNLAQFPDTVTGGDSALVEVRGSCVNDSEEFE
APRMYCSGDGGWLVPIGRCVCKPGFEENKDYCQACRPGTYKASSMDAYCSKCPPHSFSHQ
EKASECSCEKGFYRADMDPRSMACTRPPSAPENPISTLNDTSVTLEWSPPRDSGGRGDVT
YSIHCRKCAGDGRICSPCSNNVHFVPRQFGLSIPKVLITDLLSNTNYTFSVEAVNGVSDL
SPTPKQLVTVNITTSQTVNVILKERKSKDSITLAWQGPDRPNGVIVEYEVIYYEKNQRDQ
NYTVLKTKGHMMTVEGLKPGTTYVFRVRARTDGGYGNYGGEIELETSHEDMLAIGDPNQS
TILAVSIAGGIVLLIFLVACFVVSGRHCGYIKAKQDPDEEKMQFQNGRVKLPGSRTYIHP
HTYEDPNQAVRDFAKEIDASTIRIERVIGAGEFGEVCSGRLKLPSKREIYVAIKSLKAGY
SEKQRRDFLSEASIMGQFDHPNIIRLEGVVTRCKPVMIITEYMENGSLDTFLKKHDGQFT
VIQLVGMMRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAAY
TTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVISYGERPYWEMSNQDVIKAIDE
GYRLPAPMDCPVVLHQLMLDCWEKSRSERPKFGQIVNTLDKLIRNPNSLKELANSSVWED
PTTPEFSVSTVDEWLDAINMGQYKDNFANAGYVSLDSILYISMCELSKMDVTLVGHQKKI
LSAVQSLHAQGTHVQV
Download sequence
Identical sequences ENSDARP00000030606 ENSDARP00000030606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]