SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000037198 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000037198
Domain Number 1 Region: 265-536
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-82
Family Protein kinases, catalytic subunit 0.000000000631
Further Details:      
 
Domain Number 2 Region: 151-298
Classification Level Classification E-value
Superfamily SH2 domain 1.87e-40
Family SH2 domain 0.00000246
Further Details:      
 
Domain Number 3 Region: 82-160
Classification Level Classification E-value
Superfamily SH3-domain 2.67e-24
Family SH3-domain 0.0000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000037198   Gene: ENSDARG00000025319   Transcript: ENSDART00000036635
Sequence length 544
Comment pep:known chromosome:Zv9:20:349802:416783:1 gene:ENSDARG00000025319 transcript:ENSDART00000036635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEAAKLTDDRDTSLSQSGVGYRYGVDPTPQHYPAFSGTGTAVAAIPNYNNFH
GAAVSQGMTVFGGISTSTHQGTLRTRGGTGVTLFVALYDYEARTEDDLSFRKGEKFQIIN
STEGDWWDARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSTGNPRGTF
LIRESETTKGAFSLSIRDWDDVKGDHVKHYKIRKLDSGGYYITTRAQFETLQQLVQHYTE
RAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGN
TKVAIKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMGKGSLLDF
LKDGEGRALKLPNLVDMAAQVAGGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLAR
LIEDNEYTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELVTKGRVPYPGMNNR
EVLEQVERGYRMQCPQDCPSSLHELMVQCWKKDAEERPTFEYLQAFLEDYFTATEPQYQP
GDNL
Download sequence
Identical sequences F1RDG9
ENSDARP00000037198 ENSDARP00000037198 XP_005160359.1.45394 XP_021324187.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]