SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000040306 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000040306
Domain Number 1 Region: 495-588
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.09e-20
Family Tudor domain 0.0033
Further Details:      
 
Domain Number 2 Region: 918-1009
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.69e-19
Family Tudor domain 0.0022
Further Details:      
 
Domain Number 3 Region: 684-781
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000188
Family Tudor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000040306   Gene: ENSDARG00000032808   Transcript: ENSDART00000040307
Sequence length 1079
Comment pep:known chromosome:Zv9:1:11492071:11524487:1 gene:ENSDARG00000032808 transcript:ENSDART00000040307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVELVKKMLRAVLQSSKHGVAMARLQGDYRALTGEMIPFRKFGHDTLESFLRSIPGVV
RLERSIAGEVMCFAGVCEETAHIAQLVARQKNVKKTGCSKLLNFQMRTRTSHLFSHNVKP
RLSLRQPSNMTHPGRGSVTSFYSTQRKLYSTDLPSSRAPAWQMNRKSPVPEKTSVVPSKI
NTNIKTPLKKTSGTPAQQKPVNRADVELVQGRIKQLLQKYSSGVWLSKIPQLYKSMFQEE
LHIIQEVEKWTHICTVEKPGSNNIVDRLVYPVLEPVPKASPVPVKSPCKQSPNTALLKQP
TLTQKTTRTFRTLAINIPQSTPKPQTPLSPTSPNSTMMDFTLSETPKTQSLSPITPPSTP
PAHQPLTTELKQKLRQLLNKYSQGLWAHGLPQLFQEAFGCAFPQYVLEDLSLLADTCMVE
YPMPDNRKRAILYTLPCQVQTQPRSRPPPLVLPCTSNPHVPPLIIPTADFHSVFVIEINS
TNNVVVRFAGEGYSKSLEVMEEEMQNFYNNIGAGLCLLSPKIGQLVAVASSDGAMLRAQV
HQLSEDKVKVYFLDHGFFDLVSRKTVFQLRDQFMTLPFQATTCQLAGLEPFSTDPVVLKT
LQSLAVGRSLLAEIVEREDTPLVVLYDTSENDDVNVTAMCLKALQDKSMENPLQVNSVYT
NVCVTNVCSDGSVYCQLPSRGQAKLKDIMDKIEAHFISQLTWELLVSRPFCGKVCLAKYK
GKWARAEIINLHGSHVLDILFLDLGLPASLEVSELREIPPIFLKELITIPPQAIKCLLED
LNVDRAVWPPEAVLWLRETVHNKAPSCMKIVKLDETRTVHIYLFCGNEAQDIHDSVNRQL
ASCPFWKQDVYANKINKASELFLPDAGEPSGPSPAPSNALTLPPQLNLPLVGQNMDVFVS
VACHPGHFVLQPWQDLYKLVVLMGEMVLFYNKQEVTPVDIQKNNVYAAKIDNNWHRVLVK
GLLTNGLVSVYELDYGKYELINYTQLQPLIEEFRQLPFQGISAQLADVKKEVWCEEASMV
FRNHVEKKPLVAQIESVEEGEWPWERKISVYLVDTTQENKDIWIHNIMKEFLDEISRDA
Download sequence
Identical sequences F1QTF8
ENSDARP00000040306 ENSDARP00000040306 NP_001092813.1.45394 7955.ENSDARP00000040306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]