SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000040467 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000040467
Domain Number 1 Region: 374-633
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.52e-68
Family Nuclear receptor ligand-binding domain 0.0000208
Further Details:      
 
Domain Number 2 Region: 125-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-29
Family Nuclear receptor 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000040467   Gene: ENSDARG00000033160   Transcript: ENSDART00000040468
Sequence length 636
Comment pep:known chromosome:Zv9:3:23780061:23787455:1 gene:ENSDARG00000033160 transcript:ENSDART00000040468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLGLNMTTAVDTNNTGGVISYIGSCGGSPNRTSPVSMYSENSNSSMQSLTQPCFGSSF
PPSPNGSHDSSRMYTSSSSSSSSGSGEDGNSSCSGGSPRGRDDGGSARNSPNKSVATLTK
LNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNETCTIMRINRNR
CQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQNAMNNMVNNQLQNEFQLASITSN
TPCPSSSSPSNTSSSSSSPCPGLTVGPQPQPPAVPVAQSPSSPAPTSPTVQLAQSPPPLT
STPPPCTSPGVDKTIAAITRAHRETFIYAHDKLGSPLLPHNSELDNRSNNRCMAGYHLNG
HNTIYHHDNNVAHHCNNFEVQQDNSLHFQASQTPEKHQQHNNNSQRPPNSNFYSIHHGRD
EQRIPGSELSMEKHKEILLACPMNMHPYSDPNKTPQEIWEDFSLSFTPAVREVVEFAKHI
PGFSTLSQNDQVTLLKAGTFEVLMVRFSSLFNVKEKTVTFISGATYSLEALKSMGMGDLL
GTMFDFSEKLNSLELSAEELGLFTAVVLVSADRSGIENVNSVEMLQESLIRALRTLVSKS
APTDASRFTKLLLKLPDLRTLNNMHSEKLLSFRIDA
Download sequence
Identical sequences F1QR88
ENSDARP00000040467 7955.ENSDARP00000040467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]