SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000041799 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000041799
Domain Number 1 Region: 655-945
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.42e-83
Family Protein kinases, catalytic subunit 0.00000000146
Further Details:      
 
Domain Number 2 Region: 29-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.91e-72
Family Ephrin receptor ligand binding domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 326-372,432-576
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-40
Family Fibronectin type III 0.0000187
Further Details:      
 
Domain Number 4 Region: 949-1024
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.91e-20
Family SAM (sterile alpha motif) domain 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000041799
Domain Number - Region: 245-323,364-377
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00432
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000041799   Gene: ENSDARG00000023609   Transcript: ENSDART00000041800
Sequence length 1027
Comment pep:known chromosome:Zv9:11:39958895:40108036:1 gene:ENSDARG00000023609 transcript:ENSDART00000041800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDPGLLPLLVWTISMQVLGSRGTSNNEVNLLDTTKISGDWGWLTYPSHGWDAINEMDE
YFSPIHTYQVCNVMSPSQNNWLRTNWIQRDGARRIYIEMKFTLRDCNSMPGVLGTCKETF
NLYYYETDRDVGTSIWESQFSKIDTIAADESFTNVDLGVRRLKLNTEIRGVGPLGKRGFY
LAFQDIGACIAIVSVRVYYKRCTGMARNLAIFTDVVTGADSSSLVEVRGQCVDHAEERDT
PKMYCSAEGEWLVPIGRCVCSAGFEEHRDNCIACEVGFYKPVAGDQQCGKCPLHSHSETR
AALSCPCDANFYRSSTDPPSSPCTRPPSAPVNIISSVNGTSVSLEWVSPLDTGGRSDVIY
DVLCQKCDKDGLQCEDCRVGVGGGNGVVNSNVNGASGDTSGAAGGTVGALNGLVVARSGA
ALVRFIPQRTGLTEPWVTVLNLAAHANYTFRIMALNGVTHLSNEQPQSVMVNITTNQAAP
SEVMAVRQENASQNSVTLFWHEPAQPNGVILEYDIKYYEKDNEQQSYATLKSKNTSAKVS
GLKPGTSYIFQIRARTSAGCGRFSQSVEIQTGKAPPLRNTNVTIIWICMASVTGLVTFLA
VVICRKRRCGYSKAFQDSDEEKMHYQNGHVSFPEARFYIDPHTYEDPCQAVHEFAREIEA
SRIKIEKIIGSGEFGEVCYGRMKLPGKRDVPVALKTLKAGYTEKQRRDFLAEASIMAQFD
HPNVIHLEGVVTRSKPVMIITEYMENGSLDSFLRRHDGQFTIIQLVGILRGIAAGMTYLA
DLGYVHRDLAARNVLVNSNLVCKISDFGLSRVLEDDPDAAYTTSGGKIPIRWTAPEAIAY
RKFSSSSDVWSYGVVMWEVMSYGEQPYWNLTNRDVIKSVEEGYRLPAPMGCPGALHTLML
DCWQKDRNERPKFCQIVTVLDKLIRTPETLKSVETLCRLNSPLMNRSIPDFTSCRSVDEW
LDTIKMGRYKDHFAAGGYRTLGHVMSMKQHDIQRLGVTLMGHQKKIMTSVQVMRAQVLNQ
SVPSVHI
Download sequence
Identical sequences ENSDARP00000041799 ENSDARP00000041799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]