SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000045085 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000045085
Domain Number 1 Region: 406-716
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-92
Family Protein kinases, catalytic subunit 0.0000000125
Further Details:      
 
Domain Number 2 Region: 3-131
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.96e-28
Family PLC-like (P variant) 0.00000121
Further Details:      
 
Domain Number 3 Region: 238-297
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.89e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00048
Further Details:      
 
Domain Number 4 Region: 149-222
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000045085   Gene: ENSDARG00000069928   Transcript: ENSDART00000045086
Sequence length 738
Comment pep:novel chromosome:Zv9:13:7817356:7963646:-1 gene:ENSDARG00000069928 transcript:ENSDART00000045086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVFNGLLKIKICEALDLKPTAWSLRHAVGPKTQTFLLDTYIALNVDDFRVGQTSTKQKT
NSPAWHDELVTEVHDGRKIELSVFHDAPIGYDDFVANCTIQFEELLHNGSKHFEDWIDLE
PEGKVFVIIDLSGSSSEAGGCENEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQ
PTYCSHCRDFIWGVLGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQEDTAEEVGSQRFS
VNMPHKFRIHNYKVLTFCDHCGSLLWGLLRQGLQCKVCKMNVHKRCEINVAPNCGVDARG
IAKVLSDLGVTPDKLSGSVQRRKKISQGPDPHPLPISPLLEEDRCKSAPTSPCDQDIKDL
ENIRKALSFDHRSEEMKQASEGVSEETGEARENGEVKTVQAKRMMLEDFSFIKVLGKGSF
GKVMLAELRGTDEVFAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTK
DRLFFVMEYVNGGDLMFQIQRSRKFDEARSRFYAAEVTSALMFLHHNGVIYRDLKLDNIL
LDAEGHCKLADFGMCKEGILDGITTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYE
MMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKSPSKRLGCVVSQGLE
DAIKVHPFFKDIDWVLLEQRKVKPPFKPRIKTKRDVNNFDQDFTREEPVLTPVEDAIIKQ
INQEEFKGFSYFGEETLS
Download sequence
Identical sequences B8A467
ENSDARP00000045085 ENSDARP00000045085 7955.ENSDARP00000045085 XP_002664164.2.45394 XP_021328303.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]