SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000053817 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000053817
Domain Number 1 Region: 722-968
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.78e-63
Family Nuclear receptor ligand-binding domain 0.0000000596
Further Details:      
 
Domain Number 2 Region: 599-675
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-25
Family Nuclear receptor 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000053817   Gene: ENSDARG00000037025   Transcript: ENSDART00000053818
Sequence length 970
Comment pep:known chromosome:Zv9:1:36643724:36796455:-1 gene:ENSDARG00000037025 transcript:ENSDART00000053818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKRYQSCCEGAKAENKWAQMPNTADYICSAEESLTNSDVLMDIVNSSNTPNVQSICKD
NNFKNTEATMIRVNQNQPLPFPTFNNCFNNRKSETDSKELSKTVAESMGLYMNAAREADF
GFSQQGAAGGQGSPGKLYPLCGRTNEDSQAKTSGSPKMKAPPASFPPGAQLPNGGPQECA
VVSDSVPSALVTALSSSTDGSCPMSSPTGHNMVSSTTSPTYFDSDCPTLDSATSSLTHCQ
HTSPNICSPVKSSIVGSPPLPSPLSVMKSPVSSPHSIGSVRSPLSCNTNMRSSVSSPTTN
GGNTCNIKPSISSPPTAGSMSMSSPRNSSRGFSVSSPPSGLGLVQNDVNSPESREHDFKG
FEFPKVENVDGEIFNIGLDAMGVAKYIKNEPGTDFRSMCLGSSKSAMSNSPFVTHIKTEP
NREVTCSNLQFAEPQHSLGCFPSTETTYLSLRDNIDEYSLSGILGPPVSSLNGNYEPGVF
PNNGLPKGIKQETNDGSYYQENNNVPTSAIVGVNSGGHSFHYQIGAQGTMSFSRHNLRDQ
TNPLLNLISPVTGLMETWKTRPGLSQGPLTARGDGYPGAVCLTENMESASLRHTSSTAKV
CLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRVRK
CLQAGMNLGARKSKKLGKIKSISEDSSLQSSKDGPFLTSEKELSSSTALVPHTPTVAPYL
TPSVCSVLELIEPEVVFAGYDNTQPDTTDHLLTSLNQLAGKQMIRVVKWAKVLPGFRSLP
IEDQITLIQYSWMCLSSFSLSWRSYKHTNAQMLYFAPDLVFNEERMQQSAMYDLCVGMRQ
VSQEFVRLQLTYEEYLAMKVLLLLSTVPKDGLKNQGAFEEMRVNYIKELRRSVGKATNNS
GQTWQRFFQLTKLLDATHDLVRSLLDFCFYTFRESQALKVEFPEMLVEIISDQIPKVESG
QTHTLYFHKK
Download sequence
Identical sequences A6YIH7
7955.ENSDARP00000053817 NP_001093873.1.45394 ENSDARP00000053817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]