SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000056685 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000056685
Domain Number 1 Region: 339-477
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-38
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 2 Region: 916-1064
Classification Level Classification E-value
Superfamily C-type lectin-like 8.4e-35
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 3 Region: 489-624
Classification Level Classification E-value
Superfamily C-type lectin-like 6.92e-33
Family C-type lectin domain 0.00097
Further Details:      
 
Domain Number 4 Region: 1206-1348
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-33
Family C-type lectin domain 0.00084
Further Details:      
 
Domain Number 5 Region: 212-345
Classification Level Classification E-value
Superfamily C-type lectin-like 2.98e-32
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 6 Region: 778-908
Classification Level Classification E-value
Superfamily C-type lectin-like 2.41e-31
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1069-1202
Classification Level Classification E-value
Superfamily C-type lectin-like 1.53e-30
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 8 Region: 635-771
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-29
Family C-type lectin domain 0.00012
Further Details:      
 
Domain Number 9 Region: 22-149
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.55e-25
Family Cysteine rich domain 0.00041
Further Details:      
 
Domain Number 10 Region: 148-206
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-17
Family Fibronectin type II module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000056685   Gene: ENSDARG00000038822   Transcript: ENSDART00000056686
Sequence length 1426
Comment pep:known chromosome:Zv9:2:31231575:31256560:-1 gene:ENSDARG00000038822 transcript:ENSDART00000056686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIITVVVLLVLELSNCFAQSGDSFLLYNVDSNKCLTSTLNRLVTCDPHSAQQKFRWTSS
NRILNTFTKTCLGVGSKTVGKTLQPLKCNDDNALQKWECHGNTLLGLKNETLFLAVDFRG
LPEISNKTGIRSKWTIHGTQDSICSRPYEEIYSIDGNGFGQTCKFPFLYEKKWYADCTTV
DEPDQRLWCATKTDYSLYEQWGYCPTRDSKYWTKHPLTNVYYQLNDRSTLTWYQARKSCQ
QQGAELLSISEPHEQSFIAGMFQKSQGSLWIGLNKLDVSSGWQWSNGQPLRYLKWLSGFP
SSQPGYNCGVLKNGYNSEWSNDACSEKRGYICQRGHSVPTVPPEVTTGFCQSPWIPHSGN
CYLLHRTKQTWLEARDICLREGGDLLSILSTEEQSFAITQLGYSKTDQLWIGFNDRKTQM
LFEWSDQSSVPFASWEVGEPTHSAQHAEDCVLMRGEEGKWADDVCEKKYGFICKRKTSTK
ASNNDTVVTNPGCKKGWIRYGYYCYMAGSETKTFEEAKQTCEKAESRLVDVSSRVENAFL
VNLVGARPEKYFWIGLSNQKDVHTFEWTNTKQVPFTHFNSGMPGRKQGCVAMTTGIVAGL
WDVLSCSNKEKYICKQRADALVTTAAPPTTPSLDCPTEWTSIGTRDLCVKHFNVPSLQMK
TWDQALDYCRELGGDLLSIHHESDIPWKQGGGYPSWIGYRMYDPSVGYVWSDGSSSSYQS
WASDEPNNLNNMENCVEMRVSLWDDDGMWNDVNCKDKKDWYCQIHKGKTPVEVNITEPVY
NVTEDGWIEFRGSQYYGSEYSAMSMHEARAFCKRNHGDLVVINDEEERLFLWHKSKELYN
DFLIGLTVDLDGSFQWMDGSPVVFQAWEANQPAFKNSEERCAKMTISQGLWETVNCGDEY
NYFCKRSEAPPVNATVAPTQPPKGGCAPEWTQFEGKCYNVRGEMKKWSEAREYCREHGGD
LTAIMSKFQQTFLSTMIRDKSTNFWIGFSNLANGRFKWTDGSKVSFTEWAEGEPHSLSRS
YYWTKYFSDEPECVFMGRSSGSHFSKWVADDCNSTNGFICSRDVDPGIPSVPTEIPKTFV
KLGNSSFKVIQENLTWIEANRRCKAEGGHLASIRDLISQAYIELQVFRLKQPMWIGLNSE
QSNGYFLWVNKWPMTMEKWAIAEPRPNKPCAHMKINGEWKTSLCNETFYSVCEQTTDIPP
TLPAQQPGHCPKQENYSPLRWIPFRDSCYAFVTEMKSWSRAARLCMTWGASLASIRDEAE
EKFIESNLLLLESYKEFWIGLLHNHKGHWLWADNSVVDYTNWALTETDGDYEEFSYNPDC
AFISATSKNWKKRHCDYTVLPFICKTAKVMSPTIKSPHQDIKPHRVKTGLAVFLTIAVIA
ILGALAYVYYRRSQHRFLPTFENPMYNNAESAYSDKDNKSLLEVAE
Download sequence
Identical sequences ENSDARP00000056685 ENSDARP00000056685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]