SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000057122 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000057122
Domain Number 1 Region: 95-106,248-508
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-67
Family Nuclear receptor ligand-binding domain 0.000000273
Further Details:      
 
Domain Number 2 Region: 24-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-28
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000057122   Gene: ENSDARG00000039116   Transcript: ENSDART00000057123
Sequence length 511
Comment pep:known chromosome:Zv9:3:54095214:54103245:-1 gene:ENSDARG00000039116 transcript:ENSDART00000057123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHKRDRQHELKPDPESSATQEEGCPVCGDRVSGYHYGLLTCESCKGFFKRSVQNNKRYT
CAEAQNCPMDLAQRKRCPYCRFQKCVAVGMKKEAVRADRMRGGRNKFGPLYRRDRQLKQQ
RGTYHQANIAPYRVKIEGPQQLVPALPHDFHVINPNPASLGTDHYHPTQHFHPNMSQSEF
PVLLDCTMPRDRTFSDPSLPIHTVCYPGIHGYPPDKREIPFNYNPASVTPPGPMSPTVLS
TPAPTLTPASTPSSTPTPSQSLTPTSTTAPSSFFLNQLLQAEPDEKQLCMRVLASLQREQ
ACRGKHDRLNTFSIMCKMADQTLFGLVEWARNCELFKELKVDDQMVLLQSCWSELLVLDH
LCRQVAYGRDGSICLITGQQIEASTILSQAGMTLSSLVSRAQDLVTKLRSLQLDREEFVC
LKYLVLFNPDVKSVQNRRQVEQTQERVNKALMDHTMQTHPGHSDKFGQLLLRLPEVRSIS
LQVEEYLYQRHLLGDLPCNSLLTEMLHAKHT
Download sequence
Identical sequences F1QKV6
7955.ENSDARP00000057122 ENSDARP00000057122 NP_001070740.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]