SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000057558 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000057558
Domain Number 1 Region: 40-322
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-59
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 1147-1318
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.23e-41
Family Chaperone J-domain 0.000000377
Further Details:      
 
Domain Number 3 Region: 406-561
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.98e-26
Family Dual specificity phosphatase-like 0.0000929
Further Details:      
 
Domain Number 4 Region: 570-707
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.23e-18
Family PLC-like (P variant) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000057558   Gene: ENSDARG00000039384   Transcript: ENSDART00000057559
Sequence length 1318
Comment pep:novel chromosome:Zv9:5:9996493:10090568:-1 gene:ENSDARG00000039384 transcript:ENSDART00000057559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLFQSALDFLAGPGGSGGAASRDQNDFVGQVVELGELKLRIKRVIAEGGFAFVYEAQDL
GSSKDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPNVVQFCSAASISKEESDTGQAEFL
ILTELCRGQLVDFVKKVEQKGPMSCDTVLKIFYQSCRAVQHMHKQSPAVIHRDLKIENLL
ISHQGTIKLCDFGSATTLAHYPDYSWSAHKRSMVEDEITRNTTPAYRTPEMIDLYSNYPI
NEKQDIWALGCILYLLCFKQHPFEEGAKLQIVNGKYSIPQNDTKYTVFHQLIRSMLKINP
EERLSINELVNQLQEIAAARNVNPKSPITELLEQNGGFGNNSAQLPSQINNIHNSVIESP
GVYDTDPTMGGGFLDILKGGTERFLTNIKDTSSKVIQSVASYAKGDLDLSYITSRLAVMS
FPAEGVESAIKNNIEDVRLFLDSRHAGHYAVYNLSKRSYRPARFHNRVSECGWQPRRAPT
LKNLYSICKNMHQWLKQDQRNICIVHCLDGRAASAVVVCAFLCFCRLFSTAEAAVYMFSM
KRCPPGISASHKRYIEYMCDMMAEEPIIPHSKPITIRSVAMTPVPLFNKQRNGCRPFCEV
YVGDERVATTSQEYDRMRDFKMEDGRAEIPLNITVQGDVLIVIYHARSTLGGRLQAKMAS
MKMFQIQFHTGFVPRNASTVKFAKYDLDACDIQEKYPDLFQVHVNVEVEPQDRPSNKTPP
WENFATKGLNPKILFSSRDEQQEILTKFGKPELPRQPGSTACYASDPPQSENSPDDPQTE
SDSPSPQSTDTNANNFFQTLDWEVDSGVWGKRNIYKQSYNTSRHFDHADGHLDDQEDLSG
GSEEESVSYSAPIEGTLSRDTSEPLFEADFTNTPPEAQPDTEDLLGLNSEPGPAVPESGL
KSSASNSNLLNDLLFAPQTNTVPSASNEDLMGEDAGEDLFFSNSSSQPPPATNKVDIKVQ
STDFFDPFGVGSASSGSDLFGDLLGSDAANSGFKAPAPASNSSLFNLNKLASETPKMTSS
ASQPDLLSGWDSWATSGTSTTANLSTAANKPSLFVPFYALNNLITASGVSSFSKAKSQSF
DPFADLGNLGSTLPGSSSASFSGSGFKTAPSAGGPKNSGQQWQQTPRPSSGPNKPWMPPN
STARPQVVPQAAKPNYNPSFSVIGGRQERGIRGPGFGPKPKVKEDDFEDLLCTQGFGSKP
DRKMPRTIAEMRKQELSKDMDPLKLQILDWIEGKERNIRALLSTLHTVLWEGETRWRPIN
MADLVTPDQVKRVYRKAVLVVHPDKATGQPYEQYAKMIFMELSDAWSEFENQGSKALF
Download sequence
Identical sequences ENSDARP00000057558 ENSDARP00000057558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]