SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000059450 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000059450
Domain Number 1 Region: 218-354
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000605
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 2 Region: 41-127
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000209
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000059450   Gene: ENSDARG00000091927   Transcript: ENSDART00000059451
Sequence length 469
Comment pep:known_by_projection chromosome:Zv9:9:44189329:44215679:-1 gene:ENSDARG00000091927 transcript:ENSDART00000059451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEGDAGGQPSTTTISTVAVQAGDSQIVVAILKCGELVHIQLTEAQPNLLEIGNNQDET
KKLLQEHEQLLAKLKKNEGGVWALLKEADKTAAQKEGEELVYKAMAVSLSEAWTTLVNHL
EKRRSLLVLACHFFECALEFAIRIDEAEDIQSVSQKSAVTDNLNELVQRHSAIRRGMLEK
SMLVLNKSRELLDFLKDFQSQQALQYGKASQGAWSSFGKVEGLMEILQDRRRQVDLCMRQ
QQRELEAIHCICQWEQQEQEVTQKFKENALFLENSNLGFSLSENEKLLQEYKEIEQKAKD
WAVLVEKLLEQASYLLSSNESTQLQCLSEKSEKLRASHQQFWSLMMSRQAHLQESNTFYS
SANKAFEALATIESAIKELKTQPLALPELAKKHEEFSCRIKDASAESLQRGHLLLQKLEP
QSAPAGGLQRMLGYIKERMEALSRDCHAHRELTGRRQQLVASVEELMEK
Download sequence
Identical sequences ENSDARP00000059450 ENSDARP00000059450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]