SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000063175 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000063175
Domain Number 1 Region: 15-167,343-544
Classification Level Classification E-value
Superfamily L domain-like 3.46e-51
Family Leucine rich effector protein YopM 0.055
Further Details:      
 
Domain Number 2 Region: 638-784
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-42
Family Toll/Interleukin receptor TIR domain 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000063175   Gene: ENSDARG00000043032   Transcript: ENSDART00000063176
Sequence length 795
Comment pep:known chromosome:Zv9:14:733852:738712:-1 gene:ENSDARG00000043032 transcript:ENSDART00000063176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSSGWWLVSVYLTCFHPSLIPAIQRIIVNYSSQNLSSVPDDLKPSTEDLDLSLNHIQS
LNCRDFNTTPRLRFLNLSWNILENIDRDTFTSTPALEMLDLSHNGLQNLSEQPYLLHLGC
LELLDLSSNRFSAMALGEEFSMLKRLQWLGLSAKSISIQDFTHISNLTLRTLFINADGLL
TYEGNSLDDVHAEKAVIALSSTNVDIAIANDVFARFKEVEFTKVDGKMEVVQQMRSRALM
RTVRLEISNVKTTWEFLTSSVNTILSSTIRELSLTDLTLTEMKDGANQSSTHILESFSTK
RASVTTFIFDQKMLYDFFINTPARKVSLTESPIIFMTCPGTISKIQELDLSDCALTEKIF
SVNPETECGTLVNLTRLVLRGNNLKHLSPLTSRINLMDSLQYIDLSQNTLTYSENQGRCF
WPPRVLHVDLSRNGFDEVVFKCLPDSVQVLNLRHNRVSTVPADIHTFDTLQVIDLTFNRL
LDLPTCRSFPSLQKLLIRSNSIHSPVPGSLKTCQHLQDLDLSHNPFICTCALRDFASLIN
AQGIKTFRSTLRHWPDGYRCSYPESWSNSTLEDFYLPEISCNAWILAITILIPTISLIVA
VSLLCNRLDIPWYVRMMWKWTRAKHYSITSQLKKEDVERLRFHAFVSYSQKNAGWVKSQF
LPKLEGDCGLRMCHHERDFIPGKTIVQNILRCIEQSRRCVFVLSSHFVQSEWCHYELYFA
NHQKLTRGMDSILLILLEPLPLYLIPSKYYQLKTMMSRRTYLEWPQEGAKQKLFWANLRA
ALQAELPNTPDREEE
Download sequence
Identical sequences ENSDARP00000063175 ENSDARP00000063175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]