SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000063213 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000063213
Domain Number 1 Region: 31-322
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.88e-87
Family Nuclear receptor ligand-binding domain 0.0000000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000063213   Gene: ENSDARG00000043059   Transcript: ENSDART00000063214
Sequence length 327
Comment pep:known_by_projection chromosome:Zv9:23:46201462:46205599:-1 gene:ENSDARG00000043059 transcript:ENSDART00000063214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILTDEEVQRKKDLIMKRKEEEAAREARKPRLSDEQMQIINSLVEAHHKTYDDSYSDFVRF
RPPVREGPVTHSHTHTHTHTHTHSNTDTHSHSPESVDTKLNFSNLLMMYQDSGSPDSSEE
DQQSRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQS
FSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICL
LSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQ
YRSLSFQPEHSMQLTPLVLEVFGSEVS
Download sequence
Identical sequences F1REC6
ENSDARP00000063213 ENSDARP00000063213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]